KEGG   Bacillus coagulans 36D1: Bcoa_2096Help
Entry
Bcoa_2096         CDS       T01628                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcoa_2096
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcoa_2096
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcoa_2096
Enzymes [BR:bag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcoa_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2288368..2289573
Genome map
AA seq 401 aa AA seqDB search
MQTYKLPDTNGRFGTFGGRFVPETLMPAVKELEQAYREAMNDPAFHAELEKLLKQYVGRE
TPLYFAENLTKLGGGPKIFLKREDLNHTGAHKINNTVGQALLTLRMRKKKVVAETGAGQH
GVATATVCALLGLECIIFMGEEDIRRQKLNVFRMELLGAKVKSVAQGSGTLKDAVNEALR
YWVAHVEDTHYIMGSAVGPHPFPQIVRDFQSVIGKETKKQIVEQTGKLPDAVVACVGGGS
NSIGMFYPFVEDKSVKLFGVEAGGAGLGTGKHAASLSDGKLGVLHGMKTYLLQNDDGQIQ
EAYSVSAGLDYPGVGPEHSYLKETGRVTYTSVNDDEALDAFRLLSRTEGIIPALESAHAI
SFALKLAKTMGKDETIAVCLSGRGDKDVEAVSHLLGGENNG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacatacaaactgcctgatacaaacggccgtttcgggactttcggggggagattc
gtcccggaaaccttgatgccagctgttaaagaactcgagcaagcttatcgtgaagccatg
aacgatccggcttttcatgcggaattggagaaactgctgaagcaatatgtcggtcgtgaa
accccgctttattttgcagaaaacttaacaaagcttggcggcggcccgaaaattttcctg
aaacgcgaagatttgaatcatacgggggcacataaaatcaacaacacagtcggccaggcg
ctgcttacgcttagaatgagaaaaaagaaagtcgttgccgaaacgggcgccggccagcac
ggagtggcaacagcaactgtgtgcgcgctgctcggccttgaatgcataatttttatgggg
gaagaagatatccgccggcaaaagctcaatgtattcagaatggaattgctcggtgcaaag
gtcaaaagtgtggcgcagggcagcggcacattgaaggatgcggtcaacgaggcactccgc
tactgggttgcccatgtggaagacacgcactacattatgggttcagcagtcggcccgcat
ccgtttccgcaaattgtccgcgatttccaaagtgtgattgggaaagaaacgaaaaaacag
attgtagaacagacaggcaaacttcccgatgcagttgtcgcctgtgtcggcggcggcagc
aattcgatcggcatgttttatccgtttgtggaagataagtccgtaaaattgttcggcgtg
gaagcgggcggcgccggccttggaacaggaaagcacgcggcgtctttaagcgacggcaaa
ctcggcgtgcttcacggcatgaaaacatatctgctgcaaaatgacgacgggcaaatccag
gaagcttattcggtatcggccgggcttgattatccgggagtcgggccggaacacagctat
ttaaaagaaacgggccgggttacgtatacgtccgtgaatgacgatgaagcattggatgca
ttccggttgctttcaaggacagaaggcattatcccggccctggaaagcgcacatgctatc
agttttgcactgaaactggcaaaaacaatggggaaagacgaaacaatcgccgtttgcctg
tcggggcgcggggacaaagatgtagaagcagtcagccacttgcttggaggggaaaacaat
gggtga

DBGET integrated database retrieval system