KEGG   Bacillus coagulans 36D1: Bcoa_2096Help
Entry
Bcoa_2096         CDS       T01628                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcoa_2096
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcoa_2096
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcoa_2096
Enzymes [BR:bag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcoa_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2288368..2289573
Genome map
AA seq 401 aa AA seqDB search
MQTYKLPDTNGRFGTFGGRFVPETLMPAVKELEQAYREAMNDPAFHAELEKLLKQYVGRE
TPLYFAENLTKLGGGPKIFLKREDLNHTGAHKINNTVGQALLTLRMRKKKVVAETGAGQH
GVATATVCALLGLECIIFMGEEDIRRQKLNVFRMELLGAKVKSVAQGSGTLKDAVNEALR
YWVAHVEDTHYIMGSAVGPHPFPQIVRDFQSVIGKETKKQIVEQTGKLPDAVVACVGGGS
NSIGMFYPFVEDKSVKLFGVEAGGAGLGTGKHAASLSDGKLGVLHGMKTYLLQNDDGQIQ
EAYSVSAGLDYPGVGPEHSYLKETGRVTYTSVNDDEALDAFRLLSRTEGIIPALESAHAI
SFALKLAKTMGKDETIAVCLSGRGDKDVEAVSHLLGGENNG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacatacaaactgcctgatacaaacggccgtttcgggactttcggggggagattc
gtcccggaaaccttgatgccagctgttaaagaactcgagcaagcttatcgtgaagccatg
aacgatccggcttttcatgcggaattggagaaactgctgaagcaatatgtcggtcgtgaa
accccgctttattttgcagaaaacttaacaaagcttggcggcggcccgaaaattttcctg
aaacgcgaagatttgaatcatacgggggcacataaaatcaacaacacagtcggccaggcg
ctgcttacgcttagaatgagaaaaaagaaagtcgttgccgaaacgggcgccggccagcac
ggagtggcaacagcaactgtgtgcgcgctgctcggccttgaatgcataatttttatgggg
gaagaagatatccgccggcaaaagctcaatgtattcagaatggaattgctcggtgcaaag
gtcaaaagtgtggcgcagggcagcggcacattgaaggatgcggtcaacgaggcactccgc
tactgggttgcccatgtggaagacacgcactacattatgggttcagcagtcggcccgcat
ccgtttccgcaaattgtccgcgatttccaaagtgtgattgggaaagaaacgaaaaaacag
attgtagaacagacaggcaaacttcccgatgcagttgtcgcctgtgtcggcggcggcagc
aattcgatcggcatgttttatccgtttgtggaagataagtccgtaaaattgttcggcgtg
gaagcgggcggcgccggccttggaacaggaaagcacgcggcgtctttaagcgacggcaaa
ctcggcgtgcttcacggcatgaaaacatatctgctgcaaaatgacgacgggcaaatccag
gaagcttattcggtatcggccgggcttgattatccgggagtcgggccggaacacagctat
ttaaaagaaacgggccgggttacgtatacgtccgtgaatgacgatgaagcattggatgca
ttccggttgctttcaaggacagaaggcattatcccggccctggaaagcgcacatgctatc
agttttgcactgaaactggcaaaaacaatggggaaagacgaaacaatcgccgtttgcctg
tcggggcgcggggacaaagatgtagaagcagtcagccacttgcttggaggggaaaacaat
gggtga

DBGET integrated database retrieval system