KEGG   Bacillus coagulans 36D1: Bcoa_2219Help
Entry
Bcoa_2219         CDS       T01628                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcoa_2219
   01230 Biosynthesis of amino acids
    Bcoa_2219
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_2219
   00051 Fructose and mannose metabolism
    Bcoa_2219
   00562 Inositol phosphate metabolism
    Bcoa_2219
Enzymes [BR:bag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcoa_2219
Exosome [BR:bag04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcoa_2219
  Exosomal proteins of bladder cancer cells
   Bcoa_2219
  Exosomal proteins of melanoma cells
   Bcoa_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2420646..2421407
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLPEALAFTEEVKHSVPGESVVDSVICAPALFLERLVEATKGTRVK
IGAQNMHYEESGAFTGEISPVALADLHVEYVILGHSERREMFNETDEAVNKKVKAAFAHH
LTPIVCVGETLAQRENNETKQIVGSQVKAAFAGLSDDEAKQVVVAYEPIWAIGTGKSSTA
EDANEVCAYIRSVIADQFSRNVADSVRIQYGGSVKPGNIKEFMEQPDIDGALVGGASLDP
QSYLQLLEAVSHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtaaaccgatcattgcggggaactggaaaatgaataaaaccttgccggaagcgctg
gcttttaccgaagaggtaaaacattcggtacctggcgaatctgttgtcgacagcgtcata
tgtgcgcctgcgctctttttggaacgcctggtggaagcaacgaaaggcacccgcgtaaaa
attggcgcccaaaacatgcactatgaagaaagtggtgcttttacaggcgagatcagcccg
gttgcactcgctgatttgcatgttgaatatgtcatcctgggacactctgaacgccgtgaa
atgtttaatgaaacggatgaagcagtcaataagaaagtaaaagctgcttttgcccatcat
ttaacaccaatcgtttgcgtgggagaaacactggcacaacgggaaaacaatgaaacaaaa
caaatcgtcggatcgcaagtaaaagctgcttttgccgggctttctgacgacgaggcaaaa
caggttgtcgttgcctatgaacccatctgggcaatcggaacaggcaaatcttcgactgcc
gaagatgccaacgaagtttgtgcctatatccgcagtgtgatcgcggaccaattcagccgg
aatgttgctgacagcgttcgaattcaatacggcggcagtgtaaaacccggcaacattaaa
gaatttatggaacaaccggatattgacggcgcattagtgggcggtgcaagccttgaccca
caatcttatttgcaattattggaggcggtaagccatgagtaa

DBGET integrated database retrieval system