KEGG   Bacillus coagulans 36D1: Bcoa_2219Help
Entry
Bcoa_2219         CDS       T01628                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00010  Glycolysis / Gluconeogenesis
bag00051  Fructose and mannose metabolism
bag00562  Inositol phosphate metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
bag01230  Biosynthesis of amino acids
Module
bag_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bag_M00002  Glycolysis, core module involving three-carbon compounds
bag_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_2219
   00051 Fructose and mannose metabolism
    Bcoa_2219
   00562 Inositol phosphate metabolism
    Bcoa_2219
Enzymes [BR:bag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcoa_2219
Exosome [BR:bag04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcoa_2219
  Exosomal proteins of bladder cancer cells
   Bcoa_2219
  Exosomal proteins of melanoma cells
   Bcoa_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEP01401
UniProt: G2TP77
Position
2420646..2421407
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLPEALAFTEEVKHSVPGESVVDSVICAPALFLERLVEATKGTRVK
IGAQNMHYEESGAFTGEISPVALADLHVEYVILGHSERREMFNETDEAVNKKVKAAFAHH
LTPIVCVGETLAQRENNETKQIVGSQVKAAFAGLSDDEAKQVVVAYEPIWAIGTGKSSTA
EDANEVCAYIRSVIADQFSRNVADSVRIQYGGSVKPGNIKEFMEQPDIDGALVGGASLDP
QSYLQLLEAVSHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtaaaccgatcattgcggggaactggaaaatgaataaaaccttgccggaagcgctg
gcttttaccgaagaggtaaaacattcggtacctggcgaatctgttgtcgacagcgtcata
tgtgcgcctgcgctctttttggaacgcctggtggaagcaacgaaaggcacccgcgtaaaa
attggcgcccaaaacatgcactatgaagaaagtggtgcttttacaggcgagatcagcccg
gttgcactcgctgatttgcatgttgaatatgtcatcctgggacactctgaacgccgtgaa
atgtttaatgaaacggatgaagcagtcaataagaaagtaaaagctgcttttgcccatcat
ttaacaccaatcgtttgcgtgggagaaacactggcacaacgggaaaacaatgaaacaaaa
caaatcgtcggatcgcaagtaaaagctgcttttgccgggctttctgacgacgaggcaaaa
caggttgtcgttgcctatgaacccatctgggcaatcggaacaggcaaatcttcgactgcc
gaagatgccaacgaagtttgtgcctatatccgcagtgtgatcgcggaccaattcagccgg
aatgttgctgacagcgttcgaattcaatacggcggcagtgtaaaacccggcaacattaaa
gaatttatggaacaaccggatattgacggcgcattagtgggcggtgcaagccttgaccca
caatcttatttgcaattattggaggcggtaagccatgagtaa

DBGET integrated database retrieval system