KEGG   Bacillus coagulans 36D1: Bcoa_2224Help
Entry
Bcoa_2224         CDS       T01628                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bag  Bacillus coagulans 36D1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2426024..2426773
Genome map
AA seq 249 aa AA seqDB search
MMRIVPPKPFLFEAGKRAVLLLHGFTGSSADVRMLGRFLEKKGYTCHAPQYKGHGVPPEN
LLHTGPSDWWQDVMNGYQLLKEKGYHEIAVAGLSLGGVFSLKLGYTVPVKGIITMCAPMN
IKSEQTMYEGVVAYARKYKQFEGKSEAQIEQEMREFKKTPMHTLQSLQELIQDVRNHVDH
IYAPVFVVQARHDEMIRPESANIIYSEVETDHKQLKWYENSGHVITLDDEKDQLHEDVYT
FLESLDWSV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaattgtaccaccaaaaccgtttttatttgaagccggcaaaagggctgtactg
cttttgcacggatttaccggaagcagcgccgacgtcaggatgctcgggcgcttccttgaa
aaaaaaggatacacttgccatgcgccgcaatacaaagggcacggggtaccgcctgaaaac
cttttgcatacgggtccaagcgactggtggcaagatgttatgaatggctaccagttatta
aaagaaaaagggtatcatgaaattgcagtagccggattgtcattgggcggggtattttcc
ttaaaattgggttacactgtacctgtaaagggaattatcaccatgtgcgcgcccatgaac
ataaaaagcgagcaaacgatgtatgaaggcgtggttgcgtatgcccgcaaatacaaacag
ttcgaagggaaaagcgaagcgcaaatcgaacaggaaatgcgggaattcaaaaagacgccg
atgcatacgctgcaatcgctgcaagagcttattcaggatgtgcgcaaccatgtcgatcac
atttatgcgcccgtttttgtcgtacaagcgcgccatgacgaaatgatccgcccggaaagc
gccaatattatttattcagaagtggaaacagaccataagcaactcaaatggtatgagaac
tccggccatgttattacactcgacgacgaaaaagatcaacttcacgaagatgtgtacacg
tttctggagtcacttgactggtcggtttaa

DBGET integrated database retrieval system