KEGG   Bacillus coagulans 36D1: Bcoa_2421Help
Entry
Bcoa_2421         CDS       T01628                                 

Definition
(GenBank) alpha/beta hydrolase fold containing protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcoa_2421
Enzymes [BR:bag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcoa_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_5 Ser_hydrolase Peptidase_S9 Abhydrolase_3 LCAT Chlorophyllase2 Chlorophyllase DUF915
Motif
Other DBs
NCBI-ProteinID: AEP01599
UniProt: G2TN90
Position
2642870..2643676
Genome map
AA seq 268 aa AA seqDB search
MWKWEADENPKAVIVIVHGAMEHHRRYSWLIEMWRSSGYHVVMGDLPGHGMTSRAKRGHI
DSFDEYTTEIKEWVTAAYQFDLPIFLLGHSMGGLAVIRLLEQEHLKIAGVILSSPCLGLV
QYPSKLLGLLSIGLNRIAPGLRFNSPLTVQMATRNKDIQMQAVNDSLMLTKVSVRWYREL
LAAMRQAQMDTVRLPDVPFLVMQAGNDKIVDKGAVVNWFNQTSVSEKLYKEWPKCYHEIF
NEPEREDVFLYAKNFVENRLRTLGYILE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaagcagatgaaaacccaaaagcagtcatcgtcatagttcatggcgcg
atggaacatcaccgccgctacagctggctaattgagatgtggagatcaagcggctatcat
gtcgtgatgggcgatcttcccggtcatgggatgacatcaagagcaaaaagggggcatatt
gattcctttgatgaatatacaacagagataaaagagtgggtgacggcagcctatcagttc
gacctcccgatttttctcctcggtcacagcatgggcgggctggcggtcatccggctgctt
gagcaggaacatctgaaaatcgcgggggttattctttcctcgccgtgccttgggcttgtc
cagtatccttcaaagctgctcggcctgctttcgatcgggttaaaccggattgccccgggc
ctccgctttaacagcccgctgaccgtgcaaatggcaacgcggaataaggatattcaaatg
caggcggtcaacgattcattgatgctgacaaaagtatctgtccgctggtaccgtgagctg
ctcgcagcgatgcggcaggcacagatggataccgtacggctgccggacgtcccgtttctt
gtcatgcaggccgggaatgacaaaattgtggacaagggggctgtcgtaaattggtttaac
caaacttccgtgtccgaaaaattatacaaagaatggccgaaatgctaccatgaaattttc
aatgaaccggaaagggaagatgttttcctttatgcgaaaaattttgtggaaaaccggctc
cgcacgttaggctatatattagaatga

DBGET integrated database retrieval system