KEGG   Bacillus coagulans 36D1: Bcoa_2421Help
Entry
Bcoa_2421         CDS       T01628                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcoa_2421
Enzymes [BR:bag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcoa_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2642870..2643676
Genome map
AA seq 268 aa AA seqDB search
MWKWEADENPKAVIVIVHGAMEHHRRYSWLIEMWRSSGYHVVMGDLPGHGMTSRAKRGHI
DSFDEYTTEIKEWVTAAYQFDLPIFLLGHSMGGLAVIRLLEQEHLKIAGVILSSPCLGLV
QYPSKLLGLLSIGLNRIAPGLRFNSPLTVQMATRNKDIQMQAVNDSLMLTKVSVRWYREL
LAAMRQAQMDTVRLPDVPFLVMQAGNDKIVDKGAVVNWFNQTSVSEKLYKEWPKCYHEIF
NEPEREDVFLYAKNFVENRLRTLGYILE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaagcagatgaaaacccaaaagcagtcatcgtcatagttcatggcgcg
atggaacatcaccgccgctacagctggctaattgagatgtggagatcaagcggctatcat
gtcgtgatgggcgatcttcccggtcatgggatgacatcaagagcaaaaagggggcatatt
gattcctttgatgaatatacaacagagataaaagagtgggtgacggcagcctatcagttc
gacctcccgatttttctcctcggtcacagcatgggcgggctggcggtcatccggctgctt
gagcaggaacatctgaaaatcgcgggggttattctttcctcgccgtgccttgggcttgtc
cagtatccttcaaagctgctcggcctgctttcgatcgggttaaaccggattgccccgggc
ctccgctttaacagcccgctgaccgtgcaaatggcaacgcggaataaggatattcaaatg
caggcggtcaacgattcattgatgctgacaaaagtatctgtccgctggtaccgtgagctg
ctcgcagcgatgcggcaggcacagatggataccgtacggctgccggacgtcccgtttctt
gtcatgcaggccgggaatgacaaaattgtggacaagggggctgtcgtaaattggtttaac
caaacttccgtgtccgaaaaattatacaaagaatggccgaaatgctaccatgaaattttc
aatgaaccggaaagggaagatgttttcctttatgcgaaaaattttgtggaaaaccggctc
cgcacgttaggctatatattagaatga

DBGET integrated database retrieval system