KEGG   Bacillus coagulans 36D1: Bcoa_2433Help
Entry
Bcoa_2433         CDS       T01628                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bag  Bacillus coagulans 36D1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bag01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bag00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2655562..2656980
Genome map
AA seq 472 aa AA seqDB search
MADIHWMEEVLKRKEDLIRDLQGILQIRSVLDEANATEEAPLGQGVREALQYMLDLGEKD
GFKTKNVQNLAGHLEMGEGEDILGILGHVDVVPEGDGWTVDPYSGIVKDGKIYARGSSDD
KGPTMAAYYGMKIVKELGVPLEKRVRLIVGTDEESNWRCMDAYFANEEMPAIGFSPDADF
PIIYAEKGIADFDIIQDPEKTENTGQAELLSFESGRRYNMVPDYAEARIVTHGEQTELLQ
KFQDFQKETGLRGQDFVDDGVLILKLEGVSAHGAEPENGKSAGLYLAKFLNNVALDRAGA
KFIKTLNQFFGRSRGEYFGIGYKDEVSGELTINIGIMSYHQEKGGRIGLNMRYPVTFDLE
AGKTKIVSKLKEDGLRFDHFSDQKPHYVDKNDPLITTLAKVYEEQTGEEAKLLAIGGGTY
ARTLKKGVAFGALFPGREDVMHQKDEYMYVEDLLKATAIYAQSIYELAGKHA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggccgatatccactggatggaagaagtattaaaaaggaaagaggatttgatccgcgac
cttcaagggattttgcagatcagaagtgtcctcgatgaagcaaatgcaacagaagaagca
ccactcgggcaaggcgtcagggaggcactccaatatatgctcgatctcggtgaaaaagac
ggtttcaaaacgaaaaatgtgcaaaatctcgccgggcaccttgaaatgggggaaggagaa
gacattctcgggatcctcgggcatgtcgatgtggtgccggagggggacggctggacagtt
gatccgtacagcggcatagtcaaagacgggaaaatttatgcacgcggctcaagcgacgac
aaaggcccgacaatggcggcttattacggcatgaaaattgtaaaagaactcggggtgccg
cttgaaaaaagggtgcgcctcattgtcggcacagatgaagaaagcaactggagatgcatg
gacgcctattttgcaaacgaggaaatgccggccatcgggttttcgccggatgccgacttc
ccaattatttacgcagaaaaaggaattgccgattttgacatcatccaggatccggaaaaa
acggaaaatacggggcaggcggaactgctttcttttgaatcggggcgccgctacaatatg
gtgccagattatgcggaggcacgcattgtcacgcacggcgagcagacggaacttttgcaa
aaattccaggattttcaaaaggaaaccggacttcgcgggcaggattttgtggacgacggc
gttttgattttaaaactggaaggcgtttcggcccatggtgcggaaccggaaaacggaaaa
agcgcggggctttatttggcaaaatttttaaataatgtggcgcttgaccgtgccggggca
aaatttatcaaaacgctcaaccagttcttcggccgttcacgcggtgaatatttcggcatc
gggtacaaagatgaagtttcaggggaattgacgatcaatatcgggatcatgtcctatcat
caggaaaaaggcggccgcataggattaaatatgcgttatcccgttactttcgatctcgaa
gcaggaaaaacaaaaattgtgtcgaaattaaaagaagacggcttgcgttttgatcatttt
tccgatcagaaaccgcattatgttgacaaaaatgacccgctgattacgacgcttgcgaaa
gtgtatgaggagcagaccggagaggaagcgaagctgttggcaatcggcggcggtacatat
gcacgtacccttaaaaaaggtgtggcatttggggcgcttttcccgggccgcgaagatgtc
atgcaccagaaagatgagtacatgtatgtggaagatttgcttaaagcaacggctatttat
gcacagtccatttatgaactggccgggaagcacgcgtga

DBGET integrated database retrieval system