KEGG   Bacillus coagulans 36D1: Bcoa_2578Help
Entry
Bcoa_2578         CDS       T01628                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bag  Bacillus coagulans 36D1
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bcoa_2578
  Lipid metabolism
   00071 Fatty acid degradation
    Bcoa_2578
Enzymes [BR:bag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcoa_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2816637..2817410
Genome map
AA seq 257 aa AA seqDB search
MEFITIKRENAVACIEMNRPPANALAQALLKELAQAFGQLENDPETRVVLLYGKGRFFSA
GADIKEFVQLRKSGGSDALAVSGQELFEKVEAFPKPVIAAIHGAALGGGLELAMACHIRL
VTENAKLGLPELSLGLVPGFAGTQRLPRYVGRGKAFEMLWTSEPLTGTEAVQHGLANHAY
KEEELLPKARALAEKIAKKSPLALKASIELVNYSKTNDYEKGLEQESARFLELFGSKDAE
EGIKAFIEKREPRFTGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaatttattacgatcaaacgggaaaatgcggtcgcctgcattgaaatgaacaggcca
cctgccaatgcgcttgcgcaggctcttttaaaagaacttgcgcaagcgtttggccaactt
gaaaacgatcctgaaacccgggtcgtgctcctttacgggaaaggaagatttttctcggca
ggagcggatattaaagaatttgtccaattaaggaaatccggcggctccgatgcgctggcg
gtttccggtcaggaattgttcgaaaaagtggaagcgttcccgaaaccggtcatcgccgcg
atccatggcgcggcacttggcggtgggctcgaacttgcgatggcatgccatatccgcctt
gtcacagaaaatgcaaaactcggcctcccggaactgagcctcggactcgtgccgggtttt
gccggaacgcagcggctgccaaggtatgtcggacgcggcaaagcatttgaaatgctgtgg
acaagcgaaccgctgaccggaacggaggccgtgcagcacgggcttgcaaaccatgcttat
aaagaagaggaactgctcccgaaagcaagggcgctggctgaaaaaattgcaaagaaaagc
ccgctggccctgaaagcctctattgaactcgtcaattattcaaaaacaaacgattacgaa
aaaggcttggagcaggaatccgcacgttttcttgagctgttcggctcaaaagatgcagag
gaaggcatcaaagcttttattgaaaaaagggaaccgcgttttacaggggcctaa

DBGET integrated database retrieval system