KEGG   Bacillus coagulans 36D1: Bcoa_2616Help
Entry
Bcoa_2616         CDS       T01628                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bag  Bacillus coagulans 36D1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bag00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2853260..2854048
Genome map
AA seq 262 aa AA seqDB search
MTANGPLSGKNILITRGGKDGEKLAAQIEALGGTPFVVPMVSFRAYADLSASVFLRKLSA
YDWVVFTSKNGVRYFLEACSRAGIACEHLNINWAAVGKKTAACMEQSGLKVSFAPRKFTA
KDFAREFLRSGHRASRVLLPKGNLAGTEIADFLRKSGIIAEEWIVYETYMPEGAKEKLTR
LLGREHIDFALFLSPSAFRHFKGALEESGMDIAGLSTRIAVIGPSTRQAVEKAGSRAAVC
PDEYTVEAMLGALCDFVRLEEK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaaatgggcctttaagcgggaaaaatatcctgatcacaagaggcggaaaagac
ggcgaaaagctcgccgcacaaattgaagcgctcggcggcaccccttttgtcgtcccgatg
gtttccttccgtgcatatgccgacctgtccgcatctgtatttttgcgaaaactctcggca
tacgactgggttgtgtttacaagcaaaaacggggtccgttattttttggaagcatgcagc
cgtgcgggtatagcatgtgagcatttgaacataaactgggcagctgtgggaaaaaagacg
gctgcctgtatggaacagtccggtttaaaggtttcttttgcgccccggaagtttacggca
aaagattttgcccgggaatttttgcggagcggacaccgggcaagccgcgtccttctcccg
aaaggaaacttggccgggacagaaattgcggattttctaagaaaaagcggtataatagca
gaggaatggattgtctatgagacgtatatgccggagggggcaaaagaaaagcttacccgt
ttgctcgggcgggagcacatcgattttgctctgtttttaagcccgtccgccttccgccat
tttaaaggcgcgcttgaagaaagcggcatggatatcgctgggctttcaacccggatcgca
gtcatcggcccttcaaccaggcaggcagtggaaaaagccggcagccgtgcagcggtttgc
ccggatgaatacaccgtcgaggccatgcttggggcattatgcgattttgtccgtttagaa
gaaaaatag

DBGET integrated database retrieval system