KEGG   Bacillus coagulans 36D1: Bcoa_2617Help
Entry
Bcoa_2617         CDS       T01628                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bag  Bacillus coagulans 36D1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcoa_2617
Enzymes [BR:bag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Bcoa_2617
Exosome [BR:bag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcoa_2617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2854285..2855262
Genome map
AA seq 325 aa AA seqDB search
MKDLQFARHRRLRQSANMRALVRETNLTVNDLIYPIFAVEGENIKNEIASMPGVYHWSLD
RLHEIMDEVVSLGIKSVILFGVPNHKDATGTEAYHDHGIVQEAIRFIKKNYPDIIVIADT
CLCEYTDHGHCGVVEDGKILNDPSLDLLAKTAVSQAKAGADIIAPSNMMDGFVTAIRKGL
DEAGFEDVPIMSYAVKYASAFYGPFREAADSTPAFGDRKTYQMDPANRLEALREAQSDVE
EGADFLIVKPTLSYLDIVRDVRNEFRLPVVGYNVSGEYSMVKGAAQNGWIDEKAIVLEMI
TSMKRAGCDLIITYFSLDIARWLAE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttacagtttgcccgtcaccgtagacttcgccaaagtgccaatatgcgggct
ttggtgcgcgaaacgaatttaacagtgaacgacttgatttatccgatttttgcagttgaa
ggcgaaaatattaaaaatgaaattgcttcgatgccgggtgtgtatcactggtcgctggac
cggctccatgaaatcatggatgaagtcgtttcccttggcattaaatccgtcattttattc
ggcgtaccgaaccataaagatgcaaccggaacggaagcgtaccacgatcacggcatcgtt
caggaagccatccgtttcatcaagaaaaattacccggatatcattgtgatcgcggatacc
tgcctgtgcgagtacactgatcacggccattgcggcgttgtggaagatgggaaaatttta
aacgacccaagccttgacctgcttgcgaaaacggcggtcagccaggcaaaagcaggcgct
gatatcattgctccttcgaatatgatggacgggtttgtcaccgcgattcgcaaagggctt
gatgaagcaggctttgaagatgtgccgatcatgagttatgcggtcaaatatgcatccgcg
ttttacggtccgttccgcgaagctgctgacagcacacccgctttcggggaccggaaaacg
taccagatggatccggccaaccggctcgaagcattgcgtgaagcacagtcggatgtggaa
gaaggggcagattttctaatcgtaaaaccgacgctttcttatcttgatatcgtccgtgat
gtgcgcaatgaattccgcctcccggttgtcgggtataatgtgagcggggagtattccatg
gtaaaaggcgccgcacaaaacggctggattgatgaaaaggcgattgttcttgaaatgatc
acaagcatgaagcgtgccggctgcgatctcatcattacctatttttcactcgatattgct
cgctggcttgcggaataa

DBGET integrated database retrieval system