KEGG   Bacillus coagulans 36D1: Bcoa_2660Help
Entry
Bcoa_2660         CDS       T01628                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bag  Bacillus coagulans 36D1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcoa_2660
Enzymes [BR:bag01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bcoa_2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2898089..2898691
Genome map
AA seq 200 aa AA seqDB search
MYEYIKGIIDSVSPDYIVVENGGIGYRLLAPNPYIFSKSIGQERKIFTYQHVREDLIALY
GFETAEERALFQKLLNVSGIGPKGALAILAYGQPQQVVDAIENENESFLVKFPGVGKKTA
RQMILDLKGKLQGLVPEMPDEAGVEKAVPASTNQNLEEAMLALAALGYSEKEIAKVVPEL
PEEVLSADEYIKLALKAMVK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaatatattaaaggcatcattgattccgtgagcccggattacattgtcgtggaa
aacggggggatcggctaccggctgctggcgccgaacccgtatattttttcaaaaagcatc
ggacaagaacgaaaaatttttacataccagcatgtgcgcgaagatctgatcgcgctttac
ggttttgaaacggcggaagaacgggcgctgtttcaaaagctgctcaatgtttccggcatc
gggccaaaaggggcgcttgccattcttgcgtacgggcagccacagcaggtcgttgacgcc
attgagaatgaaaatgaatctttccttgtcaaattccccggtgtcggcaaaaaaacggca
aggcagatgattcttgatctgaaaggaaagctgcaaggcctcgtgccggagatgccggac
gaggcaggcgtggaaaaagcggtgcctgcatccaccaaccaaaacctcgaagaagcgatg
ctcgctttggcggcgctcggctattcggaaaaagaaatcgcgaaagtggtgccagaactt
ccggaagaagtgctttctgcggatgaatatattaaactcgctttaaaagcaatggtaaaa
taa

DBGET integrated database retrieval system