KEGG   Bacillus coagulans 36D1: Bcoa_2694Help
Entry
Bcoa_2694         CDS       T01628                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bag  Bacillus coagulans 36D1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bag03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2933914..2936337
Genome map
AA seq 807 aa AA seqDB search
MEKQHAMDLFQDEENFIKGKHLATIFHNEQNLYSVIRVRVEETNTGLEDKETVITGYFPR
IHEQETYTFFGKMQEHPKFGPQFQANRFQKDIPNTKQGVIEYLSSDLFNGIGKKTAERIV
GVLGENAISKILENPAALDEVPKLAPEKAQLIRDTLVEHQGLERVMIGLAQYGFGPQIAM
RIYQVYEDEALEKIAQNPYQLVDDIKGIGFGRADELGRQLGISGTHPHRIQAGCCYMLEM
ESMQHGHVYVLKEELAQDVKALLEEYQHVEIPMDLIENELVKLQEESKVIMEEDKVYLPS
LYFSEKGIVSNIERIMSQTEYAEQFPESEFLLALGSLEERIGVEYAPSQKEAIQKALMSP
MMILTGGPGTGKTTVIKGIVELYGELHGVSLDPQTYKKDEVFPIVLAAPTGRAAKRMAES
TGLPAMTIHRLLGMTGMEDLDDSEERQVEGKLVIIDEMSMVDTWLANQLLKALPDEIQVI
MVGDEDQLPSVGPGQVLKDLLKSNAIPVVRLTDIYRQKDGSSIIELAHHVKNGRIPENIF
QMQADRSFIRCSSGQVAEAVEKVVKSAKRKGYTAKDIQVLAPMYRGPAGIDRLNSLLQNI
FNPNENGARKELKHGDAVYRIGDKVLQLVNQPEHGVYNGDIGEIVSLFTAKENTEKQDML
IVSFDGIEVTYTKPDFNQITLAYCCSIHKSQGSEFPVVILPVVRSYYRMLRRNLLYTAIT
RSKKILILLGEEPAFRMGVEREDDQKRKTTLCEKLAEALKTAQKEAGTETALSLTEENWD
RVDPMIGMAGITPYTYAEEGQTASQPD
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaacagcatgcgatggatttattccaggacgaggaaaattttataaaaggaaag
catctcgcgaccatcttccataacgagcaaaatttgtattccgtcatccgtgtgcgggtg
gaagagaccaataccgggctggaagataaggaaacggtgattaccggctattttccgcgc
atccatgaacaggaaacgtacaccttttttggaaaaatgcaggaacacccgaaattcggc
ccccagttccaggcaaatcgcttccaaaaagacatccccaatacaaagcagggcgttatt
gagtatctttccagtgatttatttaacggcatcggcaaaaaaacggcggagcggatcgtt
ggcgtgctcggtgaaaatgcgatcagcaaaatattggaaaatcccgccgcccttgacgaa
gtaccgaaactggcaccggaaaaagcgcagctgatccgtgatacgttagttgaacatcag
gggcttgaacgtgttatgatcgggcttgcgcaatacggtttcgggccgcagattgcgatg
cgcatttaccaggtttacgaggatgaggcgctcgaaaaaattgcgcaaaatccataccag
ctcgttgatgatattaaaggcatcggtttcgggcgggccgatgaactcggccggcagctc
ggcatcagcgggacgcatccgcaccgcatccaggccggctgctgttacatgctggaaatg
gaaagcatgcagcacggtcatgtgtacgtcctgaaagaagaacttgcacaggatgtcaaa
gcccttttggaagaataccagcatgttgaaatcccgatggacttgattgaaaatgagctg
gtgaaacttcaggaagagagcaaagtcatcatggaagaagacaaagtctatcttccgtcc
ctctatttttcggaaaaaggaatcgtttccaatattgagcggattatgtcgcaaaccgag
tatgcggaacagttcccggaatctgaattcctgcttgctttaggcagtcttgaggaacgg
atcggggtcgagtatgccccgtcgcaaaaggaagccatccaaaaagcgctgatgagtccg
atgatgattttaacgggcgggcccggcacagggaaaacaacggtcattaaagggattgtg
gaactgtacggtgaattgcacggcgtctcgcttgacccgcaaacctataaaaaagatgag
gtatttccgattgttctcgcggcgccgacagggagggccgcgaaaagaatggcggagtca
actggtctgccggcgatgacgatccaccgcctgctcggcatgaccggcatggaggacctg
gacgattcagaggaacggcaagtagaaggcaagcttgtcatcattgatgaaatgtcgatg
gtcgatacatggcttgcgaaccagctgttaaaggcgctgccggatgaaatccaagtcatc
atggttggggatgaagaccagctgccgtccgtcggtccaggccaggtgctgaaagattta
ttgaaatcgaacgccattccggttgttaggctgacagacatatacaggcagaaagatggt
tcttcgattattgaactggcccaccatgttaaaaatggccgtattccggaaaatattttt
caaatgcaggcagaccgttcgtttatccgctgttcttccgggcaggtggcggaagcggtg
gaaaaagtggtgaaaagcgcgaaacggaaaggctatacggcaaaagacattcaggtgctg
gcgccgatgtacagggggccggccggcattgaccgtctgaacagcctgttgcaaaatatt
tttaatccgaatgagaacggggcccgcaaagagctgaagcacggggacgcggtttaccgg
atcggcgataaggtactgcagcttgtcaaccagccggaacacggggtgtataacggcgat
atcggcgagattgtctcgctttttaccgcaaaagaaaatacggaaaaacaagatatgctc
atcgtttcttttgatgggattgaagtgacgtatacgaagccagatttcaatcagattacg
cttgcgtattgctgttcgatccataaatcgcaaggaagcgagtttccggtcgtaattttg
ccggttgtccgcagctattaccggatgctgcgccgaaacttgctgtatacggcgattaca
aggagcaaaaaaattttaattctgcttggcgaagaaccggctttccggatgggtgtggaa
agggaagatgaccaaaagcggaagacgacactgtgtgaaaaactggctgaagcattaaaa
acggcacaaaaagaggcagggacggagacagccctgtccttaacagaagaaaattgggac
cgggtcgacccgatgattggcatggcgggcattaccccgtacacgtacgcagaagaagga
cagactgcgtcccaaccggattaa

DBGET integrated database retrieval system