KEGG   Bacillus coagulans 36D1: Bcoa_2809Help
Entry
Bcoa_2809         CDS       T01628                                 

Definition
glucokinase, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcoa_2809
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_2809
   00052 Galactose metabolism
    Bcoa_2809
   00500 Starch and sucrose metabolism
    Bcoa_2809
   00520 Amino sugar and nucleotide sugar metabolism
    Bcoa_2809
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcoa_2809
   00524 Butirosin and neomycin biosynthesis
    Bcoa_2809
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bcoa_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3036737..3037705
Genome map
AA seq 322 aa AA seqDB search
MAEKWIIGIDLGGTTTKLAFVNEAGDILHRWEIPTVTANQGEAILPNIAKSIEDELARVK
REKKDITGIGLGVPGPVDMEAGVIYETVNIGWAQHYPAAGTLQKWTGLKVVIDNDANVAA
LGEMWKGAGKGSGEMVFVTLGTGVGGGIITGGDIVHGVKGAAGEIGHITVIPEGGAKCNC
GKTGCLETVASATGVVRTAMAKLAAFSSASPLKDLYAQSGSVTAKDVFDFAKAGDALSCE
IVDETAKYLGLALASVANTLNPEKIVLGGGVSKAGETLLNPVRAYFLKYAFNTVGKSTKL
ELATLGNDAGVLGAAWLALNKI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaatggatcattggcattgatttggggggcaccaccacaaaactggcattt
gtgaatgaagcaggcgatattttacacagatgggagatcccgactgtgacggctaaccag
ggggaagcgatccttccgaatatcgcaaaatcgattgaggacgaattggcccgggtaaag
cgggagaaaaaagatatcacagggatcggcctcggcgtaccgggaccggttgatatggaa
gccggcgtgatctatgaaaccgtcaatatcggctgggcacagcattatccggctgccggg
acattgcaaaaatggacggggttaaaagtggtgatcgataatgatgcaaacgttgcggca
ctcggtgaaatgtggaagggtgccgggaaaggttccggggaaatggtcttcgttacgctt
ggcaccggtgtcggcggcggcatcattacaggcggcgacatcgtccacggtgtaaaaggg
gcggcaggcgaaattggccatattaccgttattccggaaggcggggcaaagtgtaactgc
gggaaaaccggctgccttgaaacggtcgcttctgcaacaggcgtggtcaggacagccatg
gcgaaactggctgcatttagcagcgcgtctccgttaaaagatttgtatgcccaaagcggc
tcggtaaccgctaaagatgtgtttgattttgcgaaagcgggcgatgccctttcctgtgaa
attgtggacgaaacggcaaaatacctcgggcttgcgctggcaagtgtggcaaatacgtta
aatccggaaaaaatcgtgttagggggcggggtgtcaaaagcaggcgaaacgctcttaaac
ccagtgcgcgcttattttttgaaatacgcgttcaacacggtcggcaaatcgacaaaactg
gaacttgccacattgggaaacgatgctggcgtgctcggggcagcgtggttggcgttaaat
aaaatataa

DBGET integrated database retrieval system