KEGG   Bacillus coagulans 36D1: Bcoa_2826Help
Entry
Bcoa_2826         CDS       T01628                                 

Definition
glycine cleavage system P-protein
Orthology
K00282  
glycine dehydrogenase subunit 1 [EC:1.4.4.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcoa_2826
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcoa_2826
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     Bcoa_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3049061..3050410
Genome map
AA seq 449 aa AA seqDB search
MHRYLPMTEEDKREMLDAIGVRSVGELFSDIPEKVRFKGDYRIKKAKSETALLKELSELA
GKNANLKEYASFLGAGVYDHYIPTVVDHVISRSEFYTAYTPYQPEISQGELQAIFEFQTM
ICELTGMDVANSSMYDGGTSMAEAAMLAAGQMKRKKVLVSKAVHPEYRAVLHTYAKGKGI
TVEEIPLADGCTDLEAAKKQIDGGTAAVIVQYPNFFGSLERLKEIGELAHAEKALFVVSA
NLLALGVLAPPGDFGADITTGDCQVFGIPTAFGGPHCGYFATTSKLMRKMPGRLVGETVD
ENGKRGYVLTLQAREQHIRRNKATSNICSNQALNALAASVAMSALGKKGVKEMALANMAK
AQYAKKKLAEKGFEIPFSSPFFNEFPVKLPKSVQEVNEHLLQKKIIGGYDVSKDYPEFAG
CMLIAVTELRSKEEIDQLAEEMGVVCDGE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgctacctgccgatgacggaagaagataaacgtgagatgctggatgcgatcgga
gtccgaagcgtcggggaactgttttccgacattcccgaaaaagtgcggtttaaaggggat
taccggatcaaaaaagcaaaatcggaaacggcgctgttaaaagaactgtcagaacttgcg
gggaaaaatgccaatttaaaagaatatgcctcttttttgggggcgggggtttacgaccac
tatattccaacggtcgtggaccatgtgatctcaagatccgaattttatacggcctataca
ccttaccagccggaaatctcgcaaggtgaactgcaggctatctttgaattccagacgatg
atatgcgagctgaccggcatggatgtggccaactcctcgatgtatgacggcggcacgtcc
atggctgaagcggccatgctggcggccgggcagatgaagagaaagaaagtattggtttca
aaagctgtccatccggagtaccgggccgttttacatacttatgccaagggaaaaggcatc
accgtggaagaaataccgctcgcagacggctgcaccgatctggaagcagctaaaaaacaa
atagacggcgggacagctgctgtcatcgtccagtacccgaactttttcggttcgcttgaa
cggttaaaagaaatcggcgaactggcccatgccgaaaaagctttgtttgttgtatccgcc
aatctgcttgcccttggggtgcttgcgccgccgggggatttcggcgccgatattacaacc
ggcgattgccaggttttcggcattccaactgcattcggcggcccgcattgcggctacttt
gctacaacgtcaaaactaatgcggaaaatgccggggcggctcgtcggcgaaacggtcgac
gagaacgggaaaagggggtatgtgcttacgctccaggcgcgcgaacagcatatccgccgc
aataaagcgacgtccaatatttgctctaaccaggcgctcaatgcccttgccgcatcggtg
gccatgagcgccctcggcaaaaaaggcgtaaaagaaatggcactggccaatatggcaaaa
gcacagtacgcaaaaaagaaattggcggaaaaagggtttgaaattccgttttcgtctcct
tttttcaatgagtttcccgtgaaattgccaaaaagtgttcaagaagtaaatgaacattta
ttgcagaaaaaaatcatcggcggttatgatgtgagcaaggattacccggaatttgccggt
tgcatgctcattgccgtgacggaattgcggtcaaaagaagaaattgaccaattggctgaa
gaaatgggggtcgtgtgtgatggcgaatga

DBGET integrated database retrieval system