KEGG   Bacillus coagulans 36D1: Bcoa_2826Help
Entry
Bcoa_2826         CDS       T01628                                 

Definition
glycine cleavage system P-protein
Orthology
K00282  
glycine dehydrogenase subunit 1 [EC:1.4.4.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bag01200]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bag00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3049061..3050410
Genome map
AA seq 449 aa AA seqDB search
MHRYLPMTEEDKREMLDAIGVRSVGELFSDIPEKVRFKGDYRIKKAKSETALLKELSELA
GKNANLKEYASFLGAGVYDHYIPTVVDHVISRSEFYTAYTPYQPEISQGELQAIFEFQTM
ICELTGMDVANSSMYDGGTSMAEAAMLAAGQMKRKKVLVSKAVHPEYRAVLHTYAKGKGI
TVEEIPLADGCTDLEAAKKQIDGGTAAVIVQYPNFFGSLERLKEIGELAHAEKALFVVSA
NLLALGVLAPPGDFGADITTGDCQVFGIPTAFGGPHCGYFATTSKLMRKMPGRLVGETVD
ENGKRGYVLTLQAREQHIRRNKATSNICSNQALNALAASVAMSALGKKGVKEMALANMAK
AQYAKKKLAEKGFEIPFSSPFFNEFPVKLPKSVQEVNEHLLQKKIIGGYDVSKDYPEFAG
CMLIAVTELRSKEEIDQLAEEMGVVCDGE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgctacctgccgatgacggaagaagataaacgtgagatgctggatgcgatcgga
gtccgaagcgtcggggaactgttttccgacattcccgaaaaagtgcggtttaaaggggat
taccggatcaaaaaagcaaaatcggaaacggcgctgttaaaagaactgtcagaacttgcg
gggaaaaatgccaatttaaaagaatatgcctcttttttgggggcgggggtttacgaccac
tatattccaacggtcgtggaccatgtgatctcaagatccgaattttatacggcctataca
ccttaccagccggaaatctcgcaaggtgaactgcaggctatctttgaattccagacgatg
atatgcgagctgaccggcatggatgtggccaactcctcgatgtatgacggcggcacgtcc
atggctgaagcggccatgctggcggccgggcagatgaagagaaagaaagtattggtttca
aaagctgtccatccggagtaccgggccgttttacatacttatgccaagggaaaaggcatc
accgtggaagaaataccgctcgcagacggctgcaccgatctggaagcagctaaaaaacaa
atagacggcgggacagctgctgtcatcgtccagtacccgaactttttcggttcgcttgaa
cggttaaaagaaatcggcgaactggcccatgccgaaaaagctttgtttgttgtatccgcc
aatctgcttgcccttggggtgcttgcgccgccgggggatttcggcgccgatattacaacc
ggcgattgccaggttttcggcattccaactgcattcggcggcccgcattgcggctacttt
gctacaacgtcaaaactaatgcggaaaatgccggggcggctcgtcggcgaaacggtcgac
gagaacgggaaaagggggtatgtgcttacgctccaggcgcgcgaacagcatatccgccgc
aataaagcgacgtccaatatttgctctaaccaggcgctcaatgcccttgccgcatcggtg
gccatgagcgccctcggcaaaaaaggcgtaaaagaaatggcactggccaatatggcaaaa
gcacagtacgcaaaaaagaaattggcggaaaaagggtttgaaattccgttttcgtctcct
tttttcaatgagtttcccgtgaaattgccaaaaagtgttcaagaagtaaatgaacattta
ttgcagaaaaaaatcatcggcggttatgatgtgagcaaggattacccggaatttgccggt
tgcatgctcattgccgtgacggaattgcggtcaaaagaagaaattgaccaattggctgaa
gaaatgggggtcgtgtgtgatggcgaatga

DBGET integrated database retrieval system