KEGG   Bacillus coagulans 36D1: Bcoa_2826Help
Entry
Bcoa_2826         CDS       T01628                                 

Definition
(GenBank) Glycine cleavage system P-protein
  KO
K00282  glycine dehydrogenase subunit 1 [EC:1.4.4.2]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00260  Glycine, serine and threonine metabolism
bag00630  Glyoxylate and dicarboxylate metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01130  Biosynthesis of antibiotics
bag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bcoa_2826
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcoa_2826
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     Bcoa_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEP02002
UniProt: G2TPP0
Position
3049061..3050410
Genome map
AA seq 449 aa AA seqDB search
MHRYLPMTEEDKREMLDAIGVRSVGELFSDIPEKVRFKGDYRIKKAKSETALLKELSELA
GKNANLKEYASFLGAGVYDHYIPTVVDHVISRSEFYTAYTPYQPEISQGELQAIFEFQTM
ICELTGMDVANSSMYDGGTSMAEAAMLAAGQMKRKKVLVSKAVHPEYRAVLHTYAKGKGI
TVEEIPLADGCTDLEAAKKQIDGGTAAVIVQYPNFFGSLERLKEIGELAHAEKALFVVSA
NLLALGVLAPPGDFGADITTGDCQVFGIPTAFGGPHCGYFATTSKLMRKMPGRLVGETVD
ENGKRGYVLTLQAREQHIRRNKATSNICSNQALNALAASVAMSALGKKGVKEMALANMAK
AQYAKKKLAEKGFEIPFSSPFFNEFPVKLPKSVQEVNEHLLQKKIIGGYDVSKDYPEFAG
CMLIAVTELRSKEEIDQLAEEMGVVCDGE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgctacctgccgatgacggaagaagataaacgtgagatgctggatgcgatcgga
gtccgaagcgtcggggaactgttttccgacattcccgaaaaagtgcggtttaaaggggat
taccggatcaaaaaagcaaaatcggaaacggcgctgttaaaagaactgtcagaacttgcg
gggaaaaatgccaatttaaaagaatatgcctcttttttgggggcgggggtttacgaccac
tatattccaacggtcgtggaccatgtgatctcaagatccgaattttatacggcctataca
ccttaccagccggaaatctcgcaaggtgaactgcaggctatctttgaattccagacgatg
atatgcgagctgaccggcatggatgtggccaactcctcgatgtatgacggcggcacgtcc
atggctgaagcggccatgctggcggccgggcagatgaagagaaagaaagtattggtttca
aaagctgtccatccggagtaccgggccgttttacatacttatgccaagggaaaaggcatc
accgtggaagaaataccgctcgcagacggctgcaccgatctggaagcagctaaaaaacaa
atagacggcgggacagctgctgtcatcgtccagtacccgaactttttcggttcgcttgaa
cggttaaaagaaatcggcgaactggcccatgccgaaaaagctttgtttgttgtatccgcc
aatctgcttgcccttggggtgcttgcgccgccgggggatttcggcgccgatattacaacc
ggcgattgccaggttttcggcattccaactgcattcggcggcccgcattgcggctacttt
gctacaacgtcaaaactaatgcggaaaatgccggggcggctcgtcggcgaaacggtcgac
gagaacgggaaaagggggtatgtgcttacgctccaggcgcgcgaacagcatatccgccgc
aataaagcgacgtccaatatttgctctaaccaggcgctcaatgcccttgccgcatcggtg
gccatgagcgccctcggcaaaaaaggcgtaaaagaaatggcactggccaatatggcaaaa
gcacagtacgcaaaaaagaaattggcggaaaaagggtttgaaattccgttttcgtctcct
tttttcaatgagtttcccgtgaaattgccaaaaagtgttcaagaagtaaatgaacattta
ttgcagaaaaaaatcatcggcggttatgatgtgagcaaggattacccggaatttgccggt
tgcatgctcattgccgtgacggaattgcggtcaaaagaagaaattgaccaattggctgaa
gaaatgggggtcgtgtgtgatggcgaatga

DBGET integrated database retrieval system