KEGG   Bacillus coagulans 36D1: Bcoa_3056Help
Entry
Bcoa_3056         CDS       T01628                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bag  Bacillus coagulans 36D1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bag01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bag00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3265365..3266459
Genome map
AA seq 364 aa AA seqDB search
MEKNRVVVKIGSSSLTNDAGEIDEQKFADHIGALVALHKAGHEVVVVSSGAVACGFRLLG
YPARPVTLKGKQAAAAIGQSVLIQRYREALGAYGLIPAQILLTRKDFSTKDRYHNAYSTI
TELLRRGVIPVINENDSVSVSELTFGDNDMLSALVSGLVHAGCLIILTDVNGLYSTNPKY
DRCAQRIDFIDHITPEMMKMAGGAGSKAGTGGMLSKLKAANTAVSLGVRVFIGKGKGCDK
LVRILEGKGDGTYIGATRPAVKSRKQWIALFSESAGKIYIDRGAEQALLQKGSSLLPAGI
QKISGTFQKGDVVDVYGAKGLLGKGEVLYDAEELLRVLMRPSGRAAEEVIHRDHWVPLNR
KGLG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaacagagtcgtcgtaaaaatcggaagcagttctttaacaaatgacgccggt
gaaatcgatgaacagaagtttgccgatcatatcggcgcccttgtcgcattgcacaaagcc
gggcatgaggtggtcgtcgtttcatccggcgccgtcgcgtgcgggttccggctgctcggt
tacccggcgcggcccgtcacgttaaaagggaagcaggctgctgctgctatcggccagagt
gtgctcatccagcgttacagggaagcgctcggtgcttacggcttaataccggcgcaaatt
ttgttgacccggaaagatttttccacaaaagaccggtaccataacgcttattcaacgata
acagagcttttgcgccgcggcgtcatcccagttatcaatgagaatgattccgtgtcggtc
tcagaactgactttcggcgataatgatatgctgtcagcgcttgtcagcgggcttgtccac
gccggatgcctcatcattttaacggatgtaaatgggctgtacagcacgaatccaaaatac
gaccgttgtgcgcagcgcattgattttatcgatcatattacgcccgagatgatgaaaatg
gctggaggcgccgggtcgaaagcgggaacaggcggcatgttgtcaaagttaaaagccgca
aatacagctgtctccctcggcgtccgggtgtttattggaaaaggaaaagggtgcgataaa
ctcgtcaggatactcgaaggaaaaggggacggcacgtatatcggagccacccgcccagct
gtaaagagccggaaacaatggatcgcgctgttttcggaaagtgccggaaaaatatacatt
gaccgcggcgcggaacaggctttgctgcaaaaagggagcagcctgcttccggcaggcatt
caaaaaatttccggcacattccaaaaaggcgatgtcgtggacgtctacggcgcaaaaggg
ctgcttggaaaaggggaagtgctttatgatgcagaagagctgttgcgcgtgcttatgagg
cctagcgggcgggcagcagaagaagtcattcaccgcgatcattgggtgcctttaaacaga
aaggggctgggttaa

DBGET integrated database retrieval system