KEGG   Bacillus coagulans 36D1: Bcoa_3056Help
Entry
Bcoa_3056         CDS       T01628                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bag  Bacillus coagulans 36D1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcoa_3056
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcoa_3056
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bcoa_3056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3265365..3266459
Genome map
AA seq 364 aa AA seqDB search
MEKNRVVVKIGSSSLTNDAGEIDEQKFADHIGALVALHKAGHEVVVVSSGAVACGFRLLG
YPARPVTLKGKQAAAAIGQSVLIQRYREALGAYGLIPAQILLTRKDFSTKDRYHNAYSTI
TELLRRGVIPVINENDSVSVSELTFGDNDMLSALVSGLVHAGCLIILTDVNGLYSTNPKY
DRCAQRIDFIDHITPEMMKMAGGAGSKAGTGGMLSKLKAANTAVSLGVRVFIGKGKGCDK
LVRILEGKGDGTYIGATRPAVKSRKQWIALFSESAGKIYIDRGAEQALLQKGSSLLPAGI
QKISGTFQKGDVVDVYGAKGLLGKGEVLYDAEELLRVLMRPSGRAAEEVIHRDHWVPLNR
KGLG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaacagagtcgtcgtaaaaatcggaagcagttctttaacaaatgacgccggt
gaaatcgatgaacagaagtttgccgatcatatcggcgcccttgtcgcattgcacaaagcc
gggcatgaggtggtcgtcgtttcatccggcgccgtcgcgtgcgggttccggctgctcggt
tacccggcgcggcccgtcacgttaaaagggaagcaggctgctgctgctatcggccagagt
gtgctcatccagcgttacagggaagcgctcggtgcttacggcttaataccggcgcaaatt
ttgttgacccggaaagatttttccacaaaagaccggtaccataacgcttattcaacgata
acagagcttttgcgccgcggcgtcatcccagttatcaatgagaatgattccgtgtcggtc
tcagaactgactttcggcgataatgatatgctgtcagcgcttgtcagcgggcttgtccac
gccggatgcctcatcattttaacggatgtaaatgggctgtacagcacgaatccaaaatac
gaccgttgtgcgcagcgcattgattttatcgatcatattacgcccgagatgatgaaaatg
gctggaggcgccgggtcgaaagcgggaacaggcggcatgttgtcaaagttaaaagccgca
aatacagctgtctccctcggcgtccgggtgtttattggaaaaggaaaagggtgcgataaa
ctcgtcaggatactcgaaggaaaaggggacggcacgtatatcggagccacccgcccagct
gtaaagagccggaaacaatggatcgcgctgttttcggaaagtgccggaaaaatatacatt
gaccgcggcgcggaacaggctttgctgcaaaaagggagcagcctgcttccggcaggcatt
caaaaaatttccggcacattccaaaaaggcgatgtcgtggacgtctacggcgcaaaaggg
ctgcttggaaaaggggaagtgctttatgatgcagaagagctgttgcgcgtgcttatgagg
cctagcgggcgggcagcagaagaagtcattcaccgcgatcattgggtgcctttaaacaga
aaggggctgggttaa

DBGET integrated database retrieval system