KEGG   Bacillus coagulans 36D1: Bcoa_3084Help
Entry
Bcoa_3084         CDS       T01628                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bag  Bacillus coagulans 36D1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcoa_3084
Enzymes [BR:bag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bcoa_3084
Exosome [BR:bag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcoa_3084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3288878..3290818
Genome map
AA seq 646 aa AA seqDB search
MENSVKYSQQVLPTDFELYLFHEGTLYESYTLFGAHVMEYEGKKGVRFAVWAPNAQAVAV
AGDFNGWDGSKHQMKRLKDSSIWVLFIPDLAPGELYKYEITGPSGNTFFKADPYAFYSEV
RPKTASVIYDPGTYQWQDRKWMSHKAKSDPYHEPMLIYEMHFGSWKKKANGDFYTYREMA
DELVPYVAGHGYTHIELMPMMEHPFDRSWGYQITGFYAPTSRYGKPEDFMYFIDKCHENG
LGVILDWVPVHFCKDAHGLGRFDGTPLFEPADPDMAERPIWGTYNFDFQKPEIFSFLISN
AIFWMDVYHIDGFRVDAVSSLIYLNHDRGDEKKLTNQYGGDVNLEAVEFIKKLNEAVFKM
FPHALMIAEEATSWPLVTAPVYAGGLGFNYKWNMGWVHDVLTYMQTPEEKRPDAHDLLTF
SMYYAFSENYVLPFSHDELVYGKKSLLNKMPGDFPRKFANLRLLYAYFMTHPGKKLLFMG
SEFGQFDEWKDLTQLDWMLLDFETHRTFFQFTKALNAFYQNTRSLWRLDHDPEGFEWIDP
NNRRQSIIIFMRRGKRKGDYCIVLCNFSKIKYDKFRIGVPSFGKYIEIFNTDDERFGGSG
LLNKEAIQVDKEPFHNQPYSMEISIPPLSALIFKKQSKKRQRGGKK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaactcagttaagtattcgcaacaagtcctgcccactgatttcgagctttactta
ttccacgaaggcaccctttacgaaagctatactttgttcggggcacatgtcatggagtat
gaaggaaaaaagggcgtgcggtttgctgtttgggcgccgaatgcgcaagccgttgccgta
gccggcgattttaacggctgggacggtagcaaacaccaaatgaaacgactcaaagattcg
agcatctgggtgttgtttattccggatctcgcgccgggtgagctgtataaatatgaaatt
acagggccttccggcaacactttttttaaagcggatccatatgcgttctattcggaagtg
cgtccgaaaacggcatctgtcatttatgatcccggcacatatcagtggcaggatagaaaa
tggatgagccacaaagcaaaatccgatccgtaccacgagccgatgctgatttatgaaatg
catttcggttcatggaagaaaaaagccaatggcgatttttacacctaccgtgaaatggca
gacgaactggtcccatacgttgccgggcatggctatacgcatatcgagctcatgccgatg
atggagcatccgtttgaccggtcatggggctaccagattaccggattctatgcaccgaca
agccggtacgggaagccggaagatttcatgtattttatcgacaaatgccatgagaacggc
ctcggggtgattttagactgggttcccgtccatttctgcaaagacgcccacggactcggg
cgctttgatggaacaccgctgttcgagcctgcagaccctgacatggcggaacggccgatt
tggggtacatataattttgactttcagaaacctgaaattttcagttttcttatttccaac
gccattttttggatggacgtttatcatattgatggcttccgggtggatgcagtttcttct
cttatttatttaaaccatgacaggggagacgaaaagaaattgacaaaccaatatggcggt
gatgtcaatttggaagctgtcgagtttatcaaaaaattaaatgaagccgtttttaaaatg
tttccgcatgccttaatgattgcagaagaagcaacatcgtggccgctcgtaacagcgccg
gtttacgcgggcgggctcggttttaattataaatggaatatgggctgggtgcatgatgtg
ctcacctatatgcagacaccggaggaaaaaaggcctgatgcccatgatctcctcaccttt
tccatgtactatgctttttcggaaaactatgtactgcctttttcgcatgatgaactggtt
tacgggaagaaatcgctgctcaataaaatgcccggggatttcccgcgaaaatttgcaaat
ttacgccttctttatgcttattttatgacacatccgggtaaaaaattattattcatggga
agcgaattcggacagtttgacgaatggaaagatctgacgcagctggattggatgctgctg
gattttgaaacgcaccgtaccttctttcagtttacaaaagccttgaacgcattttatcaa
aacacaagaagcttgtggcgcttggaccatgaccctgaaggttttgaatggattgatccg
aataatcgcaggcagagcatcataatttttatgagaagagggaagcggaaaggggattat
tgcatcgtcctctgtaatttttcaaaaatcaaatatgacaaattccgaatcggcgtgcct
tcatttgggaaatatatcgaaattttcaatacggatgatgaacggttcggcggcagtggt
ttgttgaacaaagaagcaatccaagtggataaggagccttttcataaccagccatacagt
atggaaatcagcattcccccactcagtgcattgatctttaaaaagcaatcaaaaaaacgg
caaaggggtggcaaaaaataa

DBGET integrated database retrieval system