KEGG   Bacillus coagulans 36D1: Bcoa_3085Help
Entry
Bcoa_3085         CDS       T01628                                 

Definition
glucose-1-phosphate adenylyltransferase
Orthology
K00975  
glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
bag  Bacillus coagulans 36D1
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcoa_3085
   00520 Amino sugar and nucleotide sugar metabolism
    Bcoa_3085
Enzymes [BR:bag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     Bcoa_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3290818..3291975
Genome map
AA seq 385 aa AA seqDB search
MAEKKWMAMLLAGGQGTRLGDLTSQLAKPAVPFGGKYRIIDFSLSNCMHSGIDTVGVLTQ
YEPHLLNSYVGNGKAWDLDKNFGGTAVLPPYVGKDGGEWYKGTANAVYQNIQYIDHYNPE
YVVILSGDHIYKMDYRKLLKSHMEAGAQASIAVIEVPWQESGRFGIMVTNAEGRIVEFEE
KPKFPKSNLASMGVYLFNWKLLREYLIQDEKNSASSHDFGKDIIPKMLKDKKKMYAYKFE
GYWKDVGTVQSFWEAHMDLLEEKPAFDLDDPDWRIFTGDANHPPQYIAPQSNIKNALINE
GSWIYGNVFHSVISDHVYIGKNSTIQDSVIMPNVTIGSNVTIERAIIASGTVIENGKKIT
PSKPNDIQLYSCPQNGEEAEIKEVL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagaaatggatggcaatgctcttagcaggcggacagggaacaaggctcggg
gatttgacgtcccagctggcaaaaccggcagtgccttttggcggcaagtacagaattatt
gatttttcactaagcaactgcatgcactcgggcattgatacggtcggtgtgctgacgcaa
tatgaaccccatcttttaaactcgtatgtcggaaacgggaaagcatgggaccttgacaaa
aatttcggcggaacagccgtgctgccgccgtatgtagggaaagacggcggcgaatggtat
aaggggacagccaatgcggtttaccaaaatatccagtatattgaccactacaacccggaa
tatgttgtcattctttcaggcgatcatatttataaaatggattatcggaaactgttaaaa
tcgcatatggaagcaggggcgcaggcgagtattgccgtaattgaagtcccgtggcaggaa
tcagggcgcttcggcattatggtaacaaacgcagaaggaagaattgttgaatttgaagaa
aaaccgaaattcccaaagagtaatctcgcgtctatgggcgtgtatttatttaattggaag
cttttgcgcgaatatttaatacaggacgagaaaaacagcgcttcctcgcacgacttcggg
aaagatattattccgaaaatgctgaaagataaaaagaaaatgtatgcttataaatttgaa
ggttactggaaagatgtcggcacggtccaaagcttctgggaagcacatatggacttgctg
gaagaaaaaccggcatttgatctggatgatccggactggcgcattttcaccggagatgcg
aaccatcctccgcaatatattgcgccccaatccaatattaaaaacgcactcatcaacgaa
ggcagctggatttacgggaatgttttccattctgtcatctcggatcatgtctatattggc
aaaaacagtacaatccaggattccgtcatcatgccgaatgtcacgatcggcagcaatgtg
accatcgaacgcgccattattgcaagcggcaccgtcattgaaaacggcaaaaaaatcacg
ccttcaaaaccaaatgatattcagttgtacagctgtccgcaaaacggcgaagaagcggaa
ataaaagaagttttataa

DBGET integrated database retrieval system