KEGG   Bacillus coagulans 36D1: Bcoa_3210Help
Entry
Bcoa_3210         CDS       T01628                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bag  Bacillus coagulans 36D1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bag00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3411907..3412554)
Genome map
AA seq 215 aa AA seqDB search
MIVSGQKEHQLIEETFKDQIDHHTVISKKLEQSGQFMEAVRSLIDLCGDDPDRDGLQETP
YRVLKAFLEYTEGYREDPKLHLAKTFDVDHDHKELVLVKDIEFYSICEHHFAPFFGVAHV
AYFPNEKITGLSKIARMVDGYARRFQVQERLTKQIADAVEEVLEPQGTMVVLEAKHMCMC
GRGVKKSDASTTTMSYRGIFEGRADLRAEFLSLLK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccggacaaaaggaacatcaactcatagaagaaacttttaaagatcaaata
gatcatcacactgtgatcagcaaaaaactcgaacagtcaggccaatttatggaagccgtc
cgcagtctgattgacttatgcggtgatgatccggaccgcgacggattgcaggaaacgcct
taccgggtgctgaaggcatttttggaatatacagaagggtaccgggaagacccgaaattg
catttggcaaaaacatttgatgtcgatcacgatcacaaggagcttgtactcgtaaaagat
attgaattttattccatatgcgagcaccacttcgcgccatttttcggcgtcgctcatgtc
gcctattttccaaatgaaaaaatcaccggcctgtcgaaaattgcgcgcatggtcgacggc
tacgccaggcgttttcaagttcaggaacggctgacaaaacaaattgcggatgcggtggaa
gaagtgcttgaaccgcagggcacgatggtggttttagaggccaagcatatgtgcatgtgc
gggcggggcgtgaaaaagtcggatgcgtccacgacaacgatgtcttaccgcggtattttt
gaagggcgggcggatttgcgcgccgaatttttgtccttactcaaatag

DBGET integrated database retrieval system