KEGG   Bacillus coagulans 36D1: Bcoa_3251Help
Entry
Bcoa_3251         CDS       T01628                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bag  Bacillus coagulans 36D1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcoa_3251
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcoa_3251
  Amino acid metabolism
   00310 Lysine degradation
    Bcoa_3251
Enzymes [BR:bag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcoa_3251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3452057..3453325)
Genome map
AA seq 422 aa AA seqDB search
MAEIKVPELAESITEGTIAQWLKHPGDHVDKGEYIVELETDKVNVEVISEEEGVVQSLLF
EEGDTVQVGDVIAIVGEGTGENSATPSAPQKEAEAPQPAQAEAPAQTQAPAPEQQKPAQE
ESESRPIASPAARKLAREKGIDLSQVPAVDPLGRVRKQDVETFNPQAAAKAPAAPEKPAA
GKVVPEEAGKPIERIRMSRRRQTIAKRLVEVTQTTAMLTTFNEIDMTAVMDLRKRKKEQF
VKDHDIRLGFMSFFTKAVVAGLKKYPYVNAEIQGNELLLKKYYDIGIAVSTEEGLVVPVV
RDCDRKSFAEIEADIAAFAQKARDNKLALSDLQGGTFTITNGGVFGSLFSTPIINGTQVG
ILGMHTIQKRPVAVDGDRIEIRPMMYVALSYDHRVIDGKDAVGFLKTVKTLIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaattaaagtgcctgaactggcagaatccatcacggaaggaaccattgcacaa
tggttgaaacatccgggggaccatgtggacaaaggtgaatatattgtagaacttgagaca
gataaagtaaatgtagaagtcatttcagaagaagagggtgtcgtccagtccctccttttt
gaagaaggggacacagtacaagttggcgatgtcattgcaattgtcggcgaaggaacaggg
gaaaacagtgcaacgccatccgcgccgcaaaaagaagcggaagcaccacaaccggcacaa
gcagaggcgccggcgcaaacacaagcgcctgctccggaacaacaaaagccggctcaggaa
gaaagcgaaagccgcccgattgcttctccggctgcccgcaaactggcacgcgaaaaaggc
attgacttatcgcaagtgccggcagtggatccgcttggcagggtaaggaaacaagatgtg
gaaactttcaatccgcaagctgcggcaaaagcgccggcagcaccggaaaaacctgcagct
ggaaaagttgtgccggaagaagccggcaaaccgattgaaagaatccgcatgtcacgccgc
cgccagacgatcgcaaaacggctcgttgaagtgacacagacaacggcgatgctgacgaca
ttcaacgaaattgatatgacagctgtcatggatttaagaaagcggaaaaaagaacagttc
gttaaagatcatgacatccgtctcggttttatgtcgttctttacaaaagccgtggttgcg
ggattgaagaaatatccgtatgttaatgcggagattcagggcaatgagctgctgctgaaa
aaatattatgatatcggcattgcagtatccacagaagaagggcttgtcgtaccggttgtc
cgggattgcgaccggaaatcgttcgcggaaattgaagcggatattgctgcatttgcccaa
aaagcacgcgataataaacttgcattaagcgatctgcaggggggaacctttacgattaca
aacggcggtgtcttcggctcgttgttctcgacaccgattatcaacgggacacaggttggt
atcctcggcatgcacaccatacaaaaacgcccggttgcagtcgatggagaccgaattgag
atccgcccgatgatgtacgtggcgctttcctatgaccaccgcgtcattgacggaaaggat
gctgtcggtttcttgaaaacggtgaagacattaattgaaaatcctgaagatttgctgctg
gaatcttaa

DBGET integrated database retrieval system