KEGG   Bacillus anthracis CDC 684: BAMEG_0574Help
Entry
BAMEG_0574        CDS       T00886                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bah00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bah00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
504041..505516
Genome map
AA seq 491 aa AA seqDB search
MKLHTLVSCLHDFPVVPKENPEITSIEADSRKVKEGSLFVCMKGYTVDSHDFAKQAAAQG
AAAIVAERPIDVDVPVVLVKNTFRSLAVLADYFYGQPTHKLHLIGITGTNGKTTTSHIMD
EIMRAHGHKTGLIGTINMKIGDETFEVKNTTPDALTLQQTFAKMVEHGVDSTVMEVSSHA
LDLGRVHGCDYDVAVFTNLTQDHLDYHKTMEEYKHAKGLLFAQLGNSYNHNREKYAVLNN
DDAVTVEYMRSTAATVVTYGIDTTSDVMAKDIAMTSGGTTFTLVTPYESVNVTMKLIGKF
NVYNVLAATAAGLVSGVSLETIIDVIKELAGVPGRFEVVDGGQNYTVIVDYAHTPDSLEN
VLKTAKQFAKGDVYCIVGCGGDRDRTKRPIMASVATQYATHAIYTSDNPRSEDPAAILDD
MVHGANGNNYEVIIDRKEAIHHAITKAKADDIIIIAGKGHETYQIIGKDVHHFDDREVAK
EAITERLNNEE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatacacttgtatcatgtttgcatgattttccagttgttccaaaagaaaat
ccagaaatcacatctatagaagctgattcacgtaaagtgaaagagggaagcttatttgta
tgtatgaaagggtatacggttgatagccatgattttgctaagcaagcagcggcacaagga
gcggctgctattgttgcggaaagaccaattgatgttgacgttccagttgtacttgtgaaa
aacacttttcgttcgttagcggttttagctgattatttttatggtcaaccaacacacaag
ttacatttaatcggtattacaggtacaaatggaaagacaacaacatcgcatattatggat
gagattatgcgcgcacatggtcataaaacggggctaattggaacgattaatatgaaaatc
ggtgatgaaacatttgaggtgaaaaatacaacgccagatgcactaacacttcaacagacg
tttgcaaaaatggttgaacacggtgtggatagcacagtaatggaagtttcatcacatgct
ttagatcttggtcgtgtacacggatgtgattacgatgtagcggtgtttacaaatttaaca
caagatcatttagactaccataaaacgatggaagaatataaacatgcaaaagggttgcta
tttgcacaacttggcaatagttataatcataatcgcgaaaaatacgcggtactgaataac
gatgatgctgtaacagtggaatatatgagaagtactgcagcaactgttgtaacgtatgga
attgatacaacaagtgatgttatggccaaagatatcgctatgacaagtggtggaactaca
tttacgcttgtaacaccgtatgaaagtgtaaatgttacgatgaaattaattgggaaattt
aatgtatataatgtactagctgcaacagcggcaggacttgtttctggtgtaagtttggaa
acaatcattgatgtaataaaggaactagctggagttcctggacgtttcgaagtagttgat
ggtggccaaaattatacagttattgttgattatgcacatacaccagatagcttagaaaat
gtattgaaaacagcaaagcagtttgcaaaaggtgacgtatattgcatcgtcggttgtggt
ggtgatagagatcgaacgaagagaccaatcatggcaagtgttgccacacaatatgcaact
cacgcaatttacacttcagataatccaagaagtgaagatccagcggctattttagatgat
atggtacatggtgcaaatggaaataattatgaagtgattattgatagaaaagaagcaata
caccatgcgatcactaaagcgaaagcagatgatatcattattattgctggtaagggtcat
gaaacatatcaaattattggtaaagatgttcatcattttgacgatcgtgaagtcgctaaa
gaagcaattacagagcgtttaaacaacgaagagtaa

DBGET integrated database retrieval system