KEGG   Bacillus anthracis CDC 684: BAMEG_0593Help
Entry
BAMEG_0593        CDS       T00886                                 

Gene name
ileS
Definition
isoleucyl-tRNA synthetase (EC:6.1.1.5)
Orthology
K01870  
isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bah00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAMEG_0593 (ileS)
Enzymes [BR:bah01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     BAMEG_0593 (ileS)
Amino acid related enzymes [BR:bah01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BAMEG_0593 (ileS)
Transfer RNA biogenesis [BR:bah03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAMEG_0593 (ileS)
 Prokaryotic Type
   Other AARSs
    BAMEG_0593 (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522436..525201
Genome map
AA seq 921 aa AA seqDB search
MEYKNTLLMPKTEFPMRGNLPKREPAMQEKWAEMNIYETVQEHTKGRPLFVLHDGPPYAN
GDIHMGHALNKVLKDFIVRYKSMTGFCAPYVPGWDTHGLPIEQALTNKGVKRKEMTVAEF
RKLCAEYAYEQVERQREQFKRLGVRADWDNPYITLEPAYEAQQIKVFGDMAKKGYIYKGQ
KPVYWSPTSESALAEAEIEYQDKKSASIYVAFSVKDGKNVLEGDEKYIIWTTTPWTLPAN
LGISVHPELEYAIVKVNDEKYIIASELFETVAKTLEWENAEVVKTVKGSELEYTVAKHPF
YDRDSLVMLGDHVTTDAGTGCVHTAPGHGEDDFIVGKKYGLEVLCPVDDKGVLTEEAPGF
EGLFYDKANKPITEKLEEVGALLKLTFITHSYPHDWRTKKPIIFRATAQWFASIEAFRKE
LLEAVAETKWVPAWGETRLHNMVRDRGDWCISRQRAWGVPIPVFYAENGDPIITDETINH
VADLFREHGSNVWFEREAKDLLPEGFTHPGSPNGEFRKETDIMDVWFDSGSSHQAVLEER
DDLQRPADLYLEGSDQYRGWFNSSLSTAVAVTGKAPYKGVLSHGFVLDGEGRKMSKSIGN
IVVPKKIMDQLGGDILRLWVSSVDYQSDVRISDDILKQVAEVYRKIRNTFRFLLGNLDDF
KPSENTVAVAELREVDRYMLVKLNDLITKVKEAYETYDFAAVYHAIHNFCTIDLSSFYLD
FAKDILYIEGANHEDRRAIQTVLYDVLVALTKLVTPILPHTADEVWPYIPGVTEESVQLT
DMPEAVQLDDAEALKTKWDAFMTLRDDVLKALEVARNEKVIGKSLNASITLYPTAEMKAM
LESINEDLKQLFIVSEYKLGGMMEEAPADAPKYEHTAVVVAQATGETCERCWVVSETIGK
DAEHETLCERCATVVKENYVK
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggagtacaaaaatacattactaatgccaaaaacagagttcccaatgcgtgggaattta
ccaaaacgtgagcctgcaatgcaagaaaagtgggcggaaatgaatatttatgaaacggta
caagaacatacgaaaggtcgtcctttatttgtactgcatgatggacctccatatgcgaat
ggcgacattcatatgggacatgcattaaataaagtattaaaagactttatcgttcgttat
aaatcaatgactggtttctgtgcaccatatgtcccaggttgggatacgcacggtttacca
attgaacaagctttaacaaataaaggtgtaaagcgtaaagaaatgacagttgctgagttc
cgtaagttatgtgcagagtatgcatatgaacaagtagaacgtcaacgtgaacaatttaag
cgtttaggtgtacgtgctgattgggataacccgtacattactttagagccagcttatgaa
gcacaacaaattaaagtgtttggtgatatggcgaaaaaaggttatatctataaaggacaa
aaaccagtttactggtcaccaacgagtgaatcagctttagcggaagctgaaattgaatac
caagataagaaatcagcatctatttacgtagcattctctgttaaagatggaaagaacgta
ttagaaggtgatgagaaatacattatctggacaacaacaccttggacgttacctgcaaac
ttaggtatttctgttcatccagaacttgaatacgctattgtaaaagtaaatgatgaaaaa
tatattattgcttctgaactatttgagacagttgcaaaaacgttagagtgggaaaatgct
gaagttgtgaaaacggtaaaaggtagcgaacttgagtatacagttgcaaaacatccattc
tatgatcgtgattcattagttatgctaggagatcacgtaacaacagatgcaggtacaggt
tgtgttcatacagcaccaggacacggggaagatgacttcattgttggtaaaaagtatgga
ttagaagtactttgcccagttgatgataaaggtgtattaacagaggaagcacctggattt
gaaggcttattctatgataaagctaacaagccaattacagaaaaattagaagaagtaggc
gcgttactgaaactaacattcattacccattcatatccacatgattggagaacgaaaaaa
ccaattattttccgtgcgacagcacagtggtttgcatctattgaagcattccgtaaagag
ttattagaagctgttgcggaaacaaaatgggtaccagcatggggagaaactcgtcttcat
aacatggttcgtgaccgtggtgactggtgtatttctcgtcagcgtgcatggggtgtgcca
attcctgtattctatgctgagaatggtgatccaattattacagatgaaacaattaaccat
gtagcagatttattccgtgagcacggttctaacgtatggttcgagcgtgaagcgaaagat
ctattaccagaaggattcacacatccaggtagcccgaatggtgaattccgtaaagaaaca
gacatcatggatgtatggttcgactcaggttcttctcaccaagcggtattagaagagcgc
gatgacttacaacgtccagctgatttatatttagaaggatctgaccaatatcgtggttgg
tttaactcttcattatcaacagcagttgctgtaacaggcaaagctccatataaaggtgta
ctaagccatggcttcgtattagatggtgaaggacgtaaaatgagtaagtcgattggaaat
atcgtcgtaccgaagaaaattatggatcaattaggcggagatattttacgcttatgggta
tcttctgttgactatcaatctgacgtacgtatttcagatgatattttaaaacaagttgca
gaagtatatcgtaaaatccgtaacacattccgtttcttattaggaaacttagacgacttt
aagccaagtgaaaatacagtagctgtagctgaacttcgtgaagtagatcgttacatgtta
gtgaaattaaatgacttaattacaaaagtaaaagaagcatatgagacatacgacttcgct
gctgtatatcatgcaattcataacttctgtacaattgatttaagttcattctacttagac
tttgcaaaagacattttatacattgaaggtgcgaaccatgaagatcgtcgtgcaatccaa
acagtattatatgatgttcttgttgcattgacgaaacttgtaacaccaatcttaccgcat
acagctgatgaagtatggccatacattccaggcgtaacagaagaaagtgtacaattaact
gatatgccagaagctgtacaattagatgatgcggaagcattaaaaacaaaatgggatgca
tttatgacattgcgtgatgacgtattaaaagcgttagaagtagcccgtaatgagaaggta
atcggtaagtcattaaatgcaagcattacgctatatccaactgcagaaatgaaagctatg
ttagagtctattaacgaagacttaaagcaattattcatcgtttctgagtacaaacttggt
ggcatgatggaagaagcgccagcagatgcaccgaagtatgaacatacagcggttgttgtt
gctcaagcaactggtgaaacatgtgaacgttgttgggtagtttcagaaacaattggtaaa
gacgctgagcatgaaacattatgtgagcgttgtgcaacggttgttaaagaaaattatgta
aaataa

DBGET integrated database retrieval system