KEGG   Bacillus anthracis CDC 684: BAMEG_0658Help
Entry
BAMEG_0658        CDS       T00886                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase (ADP-forming), beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00020  Citrate cycle (TCA cycle)
bah00640  Propanoate metabolism
bah00660  C5-Branched dibasic acid metabolism
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01200  Carbon metabolism
Module
bah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAMEG_0658 (sucC)
   00640 Propanoate metabolism
    BAMEG_0658 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BAMEG_0658 (sucC)
Enzymes [BR:bah01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BAMEG_0658 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACP14630
UniProt: C3L791
Position
584995..586155
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILELRDLDEEDA
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMTDGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcagcgaaagaattaggaacg
gatgtatgtgtagtaaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcaaaaaatttagatgaagttcgtacatatgcagagagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtcttgttttagatcgtgcaacttctcaa
gttgttttaatggcgtctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
ccagaaaaaatctttaaagaatatattgatccagcagtaggtttacaaggcttccaagca
cgccggattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttataccgtgcgtttatcgaaaaagattgttctatcgcagagattaatcca
cttgttacaacaggtgacggtaaagttatggcattagatgcgaaattaaactttgattct
aacgctttatatcgccataaagacattttagaacttcgtgatcttgatgaagaagatgca
aaagaaatcgaagcttctaaatatgacttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcgatggctacgatggatatcattaaacattaccat
ggcgatccagctaacttcttagatgttggtggcggtgcgacagctgaaaaagttacagaa
gcatttaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttattgcagaaggtgttattgaagcaacgaaacaagtaggt
cttgaattgcctttagttgtacgtcttgaaggtacaaacgttgagttaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatgacagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system