KEGG   Bacillus anthracis CDC 684: BAMEG_0673Help
Entry
BAMEG_0673        CDS       T00886                                 

Gene name
dxr2
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bah00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
600519..601661
Genome map
AA seq 380 aa AA seqDB search
MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREE
DVLKLQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIAN
KETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKT
RDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKES
IIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTKQLNLWEIGTLHFEKMNQE
RFRCLRFAYEAGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARP
SLEEILEIDAATRRFVMEQI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattagtttattaggtgcaagcggatcaattggtacacaaactttagatgta
ttacgctcgcacccagaccaattccgtctcgttgctttttctgtagggaaaaatattgac
tacgcagtaaaggtcattcaagaattttctccacaaattgtctctgtgcaaagagaggaa
gatgttttaaaattacaagctgtttctggtaatacaaaaattgtatatggtagtgaaggg
cttttagaagtagcattacatccagatgcggagattgtagtaaacgctgttgtaggtagc
gtagggttgttaccaacacttcgtgcaattgaggcgaaaaaaacaattggaattgcaaac
aaagaaacgttagtaactgcagggcatcttgtaatggaagcagcgcgaaaacataatgtt
tcgttacttccagtagacagtgaacattcagctatttttcaatgcttgaatggtgaaaat
gaaaaaagaatttctcgactaattataacggcttctggtggaagtttccgtgataaaacg
agagatgaattgcatcatgtgaccgtagaagatgcgcttcgacatccaaactggtcaatg
ggttcgaaaattacaattgattctgctacaatgatgaataaggggctagaagtaattgaa
gcacattggctttttggtatcccttatgagcaaatcgatgttgttttacataaagaaagt
attattcattctatggttgaatttgaagatcgtagtgtgatggcacagcttggctcacct
gatatgcgagtaccaattcaatacgcgcttacatatcctgatcgattacctctttcagac
acaaagcagttaaacttatgggaaataggaacgttgcattttgagaagatgaaccaagaa
cgtttccgttgcctacgttttgcgtatgaagctggaaaagcaggtggaagtatgccagct
gtaatgaatgcagcgaatgaagtagctgttgaagcttttttacaaaagagaattggtttc
ttaacagtggaagacctcattgaaaaagcaatgaaccatcacaatgtcattgcacgtccg
agcttagaggaaattctggaaattgatgcagccacaagacggtttgtgatggaacaaatt
tag

DBGET integrated database retrieval system