KEGG   Bacillus anthracis CDC 684: BAMEG_1604Help
Entry
BAMEG_1604        CDS       T00886                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAMEG_1604
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAMEG_1604
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAMEG_1604
Enzymes [BR:bah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BAMEG_1604
Exosome [BR:bah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAMEG_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467386..1469059
Genome map
AA seq 557 aa AA seqDB search
MSELALKMKRLLLVGTIILSMLCTESLMNYHTAEAKVKKVERKPKNVIIMVMDGTSSTAT
TLARLYKGKPLALDEIVTGGVRTYSAESAITDSAPAATALATGNKSNSGYVGVLPSIVSS
SGLKPMKEEDKLRPVANVLEGAKRTGRATGIVATAEIQHATPAGFSAHHVNRNNFEVLAE
QQVYQNIDVVLGGGKAALLPETDSGIRKDGEDLVKVIKNKGYDFVETKEALLGSKSNKIW
GSFSLNALAFDMDREATNPEQPTLSQMTEKAIQTLSKDKDGFFLFVEGSKPDWAAHVNDP
IGMISDVLAFDNAVAEALKFAKKDGNTMLIAVADHGNSGISIGNMNTTKGYNTTPISAYI
YPLKKAKMTLEGTINNLKADISNVEEVAKLYGLDNLTYDEKERLKTAKKKIDVGPIFTTL
LSKRANIGFTTGGHTGEDVFLYSYGPQKPYGLIQNTDVAKTMAKAMGFNLEKVTNKLFVE
SESAIKQNDAAVTIDKTDVANPVLIVKRNNVTAQLFVNKNIIRIKNKEYELGSVVVESNG
KVYVPEEAIHLFRKHSR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagttagctttaaagatgaagagattactgttagtaggaacaatcatactaagt
atgttatgtactgaaagtttgatgaattatcatacagcggaagctaaagtgaaaaaagta
gaacgcaagcctaaaaatgtaatcataatggttatggacggaacaagttctacagcaact
acattagctcgcttgtataaagggaaaccacttgcattagacgaaattgtaacaggagga
gttcgtacatattcggcggaatcagctataacagactcagctccagcagctacagcttta
gcgacggggaataaatcaaattcaggatatgtaggtgtattaccttcaattgtaagttca
tctggcttaaaaccaatgaaagaagaggataagttacgaccagttgccaatgttttagaa
ggtgcaaaacgtacgggtcgcgcaactggaattgttgctacagctgaaattcagcatgct
actcctgctggattctccgctcatcatgtgaatcgtaacaatttcgaagtgctcgcggag
caacaagtatatcaaaatatagatgtcgtattaggtgggggaaaagcagcacttctacct
gagacagatagtgggattcgaaaagacggtgaagatttagtaaaagtgatcaaaaacaaa
ggttacgactttgttgaaacgaaagaagcattattaggctctaaatctaataaaatttgg
ggctctttctcgcttaatgctttagcatttgatatggatcgtgaagcaacaaacccagag
caaccaacactttctcaaatgacggaaaaagcaattcaaacgttatcaaaagataaagat
ggcttctttttatttgtggaaggaagtaagccagactgggcagctcatgtgaatgatcca
attgggatgattagtgatgtattagcatttgataatgcagttgcagaagcattgaagttt
gcaaaaaaagatggtaatacgatgctaatagccgtagcggaccatggtaatagcggtatt
tctattgggaatatgaatacgacaaaaggatataatactacgccgatctctgcgtacatt
tatccattgaaaaaagcgaagatgacacttgaagggactatcaataatttgaaagctgat
atatcaaatgtagaagaggtagctaaattatacgggttggacaatttaacttatgatgaa
aaagaaaggttaaaaacggctaaaaagaaaatagatgtaggtccaattttcactacatta
ttgtctaagcgtgcgaacataggcttcacaacaggagggcatacaggtgaggatgtattc
ttatattcatacggtcctcaaaagccatacggtttgattcaaaatacggacgttgcgaag
acgatggcgaaagcgatgggctttaacttagaaaaagtaacaaacaaattatttgtagaa
agtgaatcagccattaagcagaatgatgcagctgtaacaatagataaaactgatgtagcg
aaccctgtactcatagtaaaacgtaataatgtaacagctcaattatttgttaacaaaaat
ataattcgtattaagaataaagagtatgaattaggaagtgttgttgtagaaagtaatgga
aaggtttacgtaccagaagaagcaattcatctatttagaaaacattctcgttaa

DBGET integrated database retrieval system