KEGG   Bacillus anthracis CDC 684: BAMEG_1822Help
Entry
BAMEG_1822        CDS       T00886                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00010  Glycolysis / Gluconeogenesis
bah00020  Citrate cycle (TCA cycle)
bah00620  Pyruvate metabolism
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01200  Carbon metabolism
Module
bah_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMEG_1822 (acoC)
   00020 Citrate cycle (TCA cycle)
    BAMEG_1822 (acoC)
   00620 Pyruvate metabolism
    BAMEG_1822 (acoC)
Enzymes [BR:bah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAMEG_1822 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ACP13394
Position
1657030..1658226
Genome map
AA seq 398 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTILDIA
VSEDEGVPPGTVICYIGKPNEKVEVHESTKVEEELTASEVPQNVQHPEPLGKEVTNKQRI
KISPVAKKIAKTENLDIRALLGTGPGGRITKVDVLKALEERVAIPEVLEESKVLPVTGMR
KAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAEVVQKRYDNKLTITDFVSRAVVLA
LGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLVVPAIRFANNLSLVELSKEIKNAAQK
ARAGNLNSDDMQGTTFTISNLGSFGIEYFTPVLNTPETGILGVGAIEHVPVYKGKKLKKG
SMLPLSLTFDHRVLDGAPAAAFLRTIKRYLEEPVTILL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttagggatggcgatgaaagagggtattattacg
agctggaatattaaagcgggtgataatgtggcaaaaggagaattaattgccagtattaac
tcggaaaaaattgaaacggaaatagaagcaccagctgatggaactattcttgatatagct
gtaagtgaagatgagggggttccacctggcactgtaatttgctacattggtaaaccgaat
gaaaaagtagaggtacatgaaagcacaaaggttgaggaagaactgacagcgagtgaagta
ccacaaaatgtacaacatccagaaccgttagggaaagaagttacgaataaacaaagaatc
aaaatatctcctgtagcgaagaagattgcgaaaactgaaaatcttgatattagagcatta
cttggtacaggtccaggtggaagaattacaaaggtagatgtattaaaggcacttgaagaa
agagtagcaattccagaagtacttgaagaaagtaaagtacttcctgttactggtatgcgg
aaagcaatcgcaaatcgtatgcatgcaagcttacaaaatagtgcgcaattaacattaacg
atgaaagtagatgtgacagatttagttgctttacataaagaaatagcggaagttgtacaa
aaacgatacgataacaaattaaccattacggatttcgtttctcgagctgttgtattagcg
cttggggagcataaagaaatgaacagcgcttatatagatgatgcaattcatcaatttgaa
catgttcatttaggtatggcagtcgcattagaaaaaggattagtcgttccagctattcgc
ttcgcaaataatctctcattagtagagttatctaaagagattaagaatgcggcacaaaag
gcacgagcaggcaatttaaatagtgatgatatgcaaggaacaacatttacaattagtaat
ttaggaagcttcggtattgaatattttacacccgtattaaacacaccagaaactggtatt
ttaggtgtaggtgcaattgaacatgttcctgtatataaagggaaaaaattaaaaaaagga
agtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcaccagcagct
gcatttttacgcacaattaaacgctatttagaagaacctgtaacaattcttttataa

DBGET integrated database retrieval system