KEGG   Bacillus anthracis CDC 684: BAMEG_2180Help
Entry
BAMEG_2180        CDS       T00886                                 

Gene name
hemY2
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bah00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1983875..1985275)
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKFKKDNNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLVKDLNLEGEMVYNETGISYIYSDNTLHPIPSDTIFGIPMSVESLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLSLFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEMLTETV
VKKGAVTTAVSKQGDRYEISFANHDSIHADYVVLAAPHDIAETLLQSNELNEQFHTFKNS
SLVSIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKNYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQALQTL
QEKMMNLYPNIYLAGASYYGVGIGACIGNGKNIANEIIATLNEPSN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggttgttgttatcggtggaggtataacgggactttctactatgttttattta
gaaaaattcaaaaaggataataatatcgatttaaatttaatccttgtagaaaaagaagag
tacttaggtggtaaaatccatagtgtagaagaaaaggattttattatggaatcaggagcg
gattctattgttgcacgtaatgaacatgttatgccacttgtaaaagatttaaatttagaa
ggagaaatggtatataacgagacgggtatttcttacatatattctgataatactttacat
ccaattccgtctgacactatatttgggataccgatgagtgtcgagtcgttgtttagcagt
acgctagtatcaacgaaggggaaaattgttgctttaaaagattttataacgaaaaataaa
gagtttacaaaagatacatccctttccctatttttagaaagctttttagggaaagaatta
gtagaaagacaaattgcgccagtgctttcaggtgtatattctggtaaattgaacgagctt
acaatggcatctacattaccatatttactggactataaaaataaatatggaagtattatt
aaaggttttgaagagaataaaaaacagtttcaatcagcaggaaacaaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaaatgctgactgagacggtt
gttaagaaaggtgctgtaacgacagctgtaagcaaacaaggtgatcgctatgaaatctct
tttgcaaatcacgattcaatccacgctgattatgttgttttagcagctccgcatgatatc
gcagaaactttattacagtctaatgagttaaacgaacagtttcatacatttaaaaactca
tctcttgtaagtatttacttaggatttgacatactagatgaacaattaccggcggacggt
acaggatttatcgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagc
cggaagtggaaacatacatctggaaaacaaaaactattagtgagaatgttttataagagt
actaatccagtatatgaaacgattaaaaattatagtgaagaagaattagtacgggttgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagtgaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcgcttcaaacatta
caagaaaaaatgatgaatctttaccctaatatatacttagctggcgcttcctattatggt
gttggtattggtgcgtgtattggaaatggaaagaacattgcaaatgaaatcattgcaaca
ttaaatgaaccatcaaattaa

DBGET integrated database retrieval system