KEGG   Bacillus anthracis CDC 684: BAMEG_2463Help
Entry
BAMEG_2463        CDS       T00886                                 

Gene name
narI
Definition
respiratory nitrate reductase subunit gamma (EC:1.7.99.4)
Orthology
K00374  
nitrate reductase gamma subunit [EC:1.7.99.4]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bah00910]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bah02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2251034..2251723)
Genome map
AA seq 229 aa AA seqDB search
MMDQFLWVLFPYIIFAIFIGGHIFRYNYDQFGWTSKSSELLEKKMLRIGSILFHFGIMFV
IGGHVMGILIPEAVYRSIGISEHMYHVVAISFGLPAGIASIIGLIILTYRRVTVKRIIAT
STKGDYIALILLLIVMLAGLSSTFLNIDSKGFDYRTTIGPWFRSLFIFQPKVEYMTEVPV
WFKIHILAGLGLFAVWPFTRLVHVFSAPIKYISRSYVIYRRRIPNELKK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatggatcaatttctatgggtattgtttccctatatcatttttgcaatctttatcggt
ggacatattttcagatacaactatgatcaatttggttggacatcaaaatctagtgaacta
ttagaaaagaaaatgctccgaatcggaagtatattattccactttgggattatgttcgta
attggcgggcatgttatggggattttaattccagaagctgtataccgttccataggtatt
tctgagcatatgtatcatgtagtagcaattagttttggtcttccggcaggtattgcttct
atcatcggtttaattatattaacgtaccgccgcgtaactgtaaaacgtatcattgcaaca
agtacaaagggagattatattgcgcttattctattacttatcgtaatgttagcaggactt
tcctcaacgtttttaaatatcgactcaaaaggatttgattatcgtacaacgatcggtcca
tggttccgaagcctcttcattttccaaccgaaagttgaatatatgacggaagtacctgta
tggtttaaaattcatattcttgcagggctagggcttttcgcagtatggccattcacaaga
ctggtacatgtatttagtgccccaattaaatatataagccgtagttatgttatttacaga
agacgtattccgaatgaattgaaaaaataa

DBGET integrated database retrieval system