KEGG   Bacillus anthracis CDC 684: BAMEG_3337Help
Entry
BAMEG_3337        CDS       T00886                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00260  Glycine, serine and threonine metabolism
bah00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01130  Biosynthesis of antibiotics
bah01230  Biosynthesis of amino acids
Module
bah_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAMEG_3337 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAMEG_3337 (trpB)
Enzymes [BR:bah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAMEG_3337 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACP12950
UniProt: C3LAV8
Structure
PDB: 

Jmol
Position
complement(3030437..3031630)
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEAFQKELNHYLKTYVGRET
PLYFAENMTEYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKEDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcgatggaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaaca
ccgctttatttcgctgagaatatgacggagtattgcggaggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaacaatacaattggtcaggcactt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggggctggacaacacggt
gttgcaacagctacggtatgtgcccttctcggtttagagtgcgtcatctttatgggagaa
gaagatgtgagacgtcaaaaattaaatgtgtttcgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacacgtgcatgatacgcactacattatgggatctgttctcggaccgcatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattgggaatgagacgaaaaaacaatat
gaagcgttagaaggaaagttaccagaagcagtcgttgcttgcattggtggtgggagtaac
gcaatgggaatgttttatccgtttgtacatgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggtgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtc
ggcgttttacacggatcgatgatgtatcttctgcaaaatgaagaaggacaaattcaagaa
gcgcactctatttcagcaggacttgattacccaggtgttggtccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaggcgttagaagcgttt
cagttattaacgaaaaaagaagggattatcccggcgttagaaagctcgcatgctgtcgca
tacgcattaaaattagcgccgcaaatgaaggaagatgaaggacttgtcatttgtttatcc
ggccgtggtgataaagatgtagagagtataaaacgttacatggaagaggtgtaa

DBGET integrated database retrieval system