KEGG   Bacillus anthracis CDC 684: BAMEG_3425Help
Entry
BAMEG_3425        CDS       T00886                                 

Gene name
asnO1
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAMEG_3425 (asnO1)
Enzymes [BR:bah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BAMEG_3425 (asnO1)
Peptidases [BR:bah01002]
 Cysteine Peptidases
  Family C44
   BAMEG_3425 (asnO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3110919..3112766)
Genome map
AA seq 615 aa AA seqDB search
MCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPEGGK
QPMTCLKDEANYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEECVDH
LNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILAHPDVKAEVTLE
GLSEIFGLGPSRTPGHGIYTGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEETVE
KTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYEKSGKGQLHTYSVDYEDND
KYFKANAFQPNSDAPFIHLMTETFQTIHHRCVISNEQLAQYLTEAVLVRDLPGMADIDSS
LLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKKEWR
NKLNLQQYVQQRYEESIQEVPILDGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSMGAS
LEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGLLPNDILYRKKSPYPKTHNP
HYTKAVTVWIQDLLTDKGSILHELFDKEQLSGLIESGGSAFQTPWYGQLMTGPQLLAHLA
QIHVWFKEYGVNIKE
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattacaggatgggtggattataaacgctcattagaaggagaacgggacgtc
gttacgaagatggctgagacgttagcgaagcgtggtccagatgataataaagtttggatt
aaaggcaatgtcgcatttgggcataaacggttaatcgttgttgatcctgaaggtggtaaa
cagccgatgacttgtttaaaggatgaagcaaattatgcaatttgctataacggcgaactg
tataacacggaagacattcgaaaggaactattaagaagaggatatacgttcaaaggtcac
tctgatacggaagtattgttagcttcttatatcgaatggaaagaagaatgtgtcgatcat
ttaaacggtatatatgcgtttgctgtatgggatgaacagaaagaacaagtgtttattgcg
cgcgatcgattaggggtaaaaccactattttataaatatgacagtgggcgattactattt
ggctcagagttaaaagcgatattggcgcatccagatgtgaaggcggaagtgacgttagaa
ggattatctgaaatatttggccttggaccatctagaacgcctggtcacggtatttatact
ggcataaaagaattacgtccaggtcatgcgatgacattttcgaagaacggtttatgtata
tggagatattggaatgtagaaagtaaaaagcatgaagattcttttgaagaaacagtagaa
aaaacacgctttttattacaagatgcgattacaaggcagctcgtttctgatgtaccatta
tgcacttttttatcaggcggtgtagattcaagcgctataacagcaattgctgcgaaagaa
tacgaaaaatcgggaaaaggtcaattacacacgtattcggttgattacgaagataatgac
aaatactttaaagcaaatgcgtttcagccaaattcagatgcaccatttattcatttgatg
actgagacgtttcaaacgatccatcatcgttgcgtcatttcaaatgaacaattagcgcag
tatttaacagaagcagtactcgttcgtgatttgcctggtatggcagatattgattcgtca
ttattatggttttgtcgtgaaattaaacaagattttgtcgttggtttatctggggaatgt
gcagatgaaatatttggtggttatccatggttttatagagaagatgatttacaatcgagt
gcatttccgtggatgcgttctacagaagcgcgtgaacaattgctaaagaaagaatggaga
aataaattaaatttacaacaatatgtacagcagcgctatgaagaatccattcaagaagtt
cctattttagatggggaaagtccgctagaagcaaaaagacgccaattattttatttaaat
atggtatggtttatgacaacattattagacagaaaagaccgcatgagtatgggggcaagc
ttagaagtgcgcgttccatttgcagatcaccgacttgtcgaatatgcgtggaatattcct
tgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattgcgtaaagcgttagaaggg
ttacttccaaatgacatcttatatagaaagaagagcccgtatccaaaaacacataatccg
cactatacgaaagcagtaacagtatggatacaagatttattaacggataaaggctcaatt
ttacacgagctatttgataaagaacagctgagtggattaattgagtcaggcggcagtgca
ttccaaacgccatggtatggtcaattaatgactgggccacagcttttagctcatttagca
caaattcatgtttggtttaaagaatatggagtaaatattaaagaatag

DBGET integrated database retrieval system