KEGG   Bacillus anthracis CDC 684: BAMEG_3448Help
Entry
BAMEG_3448        CDS       T00886                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAMEG_3448 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BAMEG_3448 (aceA)
Enzymes [BR:bah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BAMEG_3448 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3131303..3132580)
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagagagctgggaattagatacgcgttggaaa
gggattacacgtccatattcggcagaagatgtaattcgcctgcgcggatcaattgatatc
gagcatacattagcgcgccgcggtgctgaaaagctttgggcatcgcttcatacagaagat
tacattaacgcacttggggcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcaatttatttaagtggatggcaagtagcggccgatgcaaacctgtctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtcgtaaaacgaatt
aatcaaacacttcaacgtgcggatcaaattcagcatatggaaggaagcggtgatacagat
tatttcgtgccaattgtagcagatgcagaagctggatttggcggacaattaaacgtattt
gaactgatgaaaggtatgattgaagcgggtgcgtctggcgtgcactttgaagatcaatta
tcttcagagaagaaatgcggtcatttaggcggaaaagtattactaccaacgcaaacagca
gtgcgtaatttaatttcggcacgccttgctgcagacgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgatcctgttgat
aaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaagcaggtctt
gaccaagcgattgcacgtggtttagcgtacgctccttacgcagacctcgtttggtgtgaa
acttcagaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaggagcat
ccagggaagctacttgcatataactgctcaccttcattcaactggaaacaaaaactagat
gaaaaaacaattgcaagcttccaaaaggaaatcgcatcttacggttacaagttccaattc
gtaacacttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgcagctgaaaaa
cacggctactctgcaacacgtcatcaacgcgaagtaggaacaggttactttgatgaagtg
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaaggatctacagaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system