KEGG   Bacillus anthracis CDC 684: BAMEG_3921Help
Entry
BAMEG_3921        CDS       T00886                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAMEG_3921 (rbsK)
Enzymes [BR:bah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BAMEG_3921 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3555073..3555969)
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGDDNYGTVVKRNLENERVFIDYVVPVTDAATGIAHIVLAEEDNSIVVVQGANALVNESV
VNRSKDLLIKADMVVLQLEIPLETVKYVLAICQEHKIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagtatttcaatggacttagtggccgtttcaaaaaaa
cgtccgaaagcaggggaaacagtaattggtgaagcatttcatacaattccaggagggaaa
ggagctaaccaggcggttgctgcagctagattaggcgcaaatgtagcgatggttggagca
gtaggagacgataattatggaactgtagtgaagagaaatttagagaacgaacgcgttttt
atcgactatgtggtaccggttacagatgcggcgacaggaattgctcatatcgttttagca
gaagaggataacagtattgttgtcgtgcaaggggcgaatgctcttgtaaatgagtcggtt
gtaaatcgttcaaaagatcttcttataaaagctgatatggttgtgcttcaactagagatt
ccgcttgaaacagtaaaatatgtattggctatttgtcaggaacacaaaatcccggttatg
ttaaatccagcgccagcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acaccaaatgaacatgagtgccgcatcgtattagatgatttcacatcgccaattgaagat
ttactggctaaatatccgaataaactattgatgacagaaggttctaacggtgtacgtttc
cataatggtacggagattgtacatgttcctagcattgctgttgatgtagtagatacgact
ggagctggtgatacatttaatggtgcattagcagttgcgctttctgaaggagaaacactt
caaaaagcaattcgttttgcgaatattgctggtggtctttctgtaacgaagcttggggcg
caaggcggtatgccaacgagagatagagtacgtgaagtgcaggtgattgtcgggtga

DBGET integrated database retrieval system