KEGG   Bacillus anthracis CDC 684: BAMEG_4223Help
Entry
BAMEG_4223        CDS       T00886                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00010  Glycolysis / Gluconeogenesis
bah00020  Citrate cycle (TCA cycle)
bah00620  Pyruvate metabolism
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01200  Carbon metabolism
Module
bah_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMEG_4223 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BAMEG_4223 (pdhC)
   00620 Pyruvate metabolism
    BAMEG_4223 (pdhC)
Enzymes [BR:bah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAMEG_4223 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NUP50
Motif
Other DBs
NCBI-ProteinID: ACP14148
Position
complement(3830208..3831467)
Genome map
AA seq 419 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFIKPGDEVNEDDVLLEVQNDKAVVEIPSPVKGKVLEVL
VEEGTVAVVGDTLIKFDAPGYENLKFKGDDHDEAPKAEATPAATAEVVNERVIAMPSVRK
YARENGVDIHKVAGSGKNGRIVKADIDAFANGGQAVAATEAPAAVEATPAAAKEEAPKAQ
PIPAGEYPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTELVAHRKKFKAVAADK
GIKLTYLPYVVKALTSALREYPMLNTSLDDASQEVVHKHYFNIGIAADTDKGLLVPVVKD
TDRKSIFTISNEINDLAGKAREGRLAPAEMKGASCTITNIGSAGGQWFTPVINHPEVAIL
GIGRIAEKPVVKNGEIVAAPVLALSLSFDHRLIDGATAQKALNQIKRLLNDPQLLVMEA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactaccagatatcggtgaaggtatccacgaaggtgaaatcgta
aaatggtttattaaaccaggcgacgaagtaaacgaagacgacgtacttcttgaagtacaa
aatgataaagcagtagtagaaattccttctcctgttaaaggtaaagtacttgaagtactt
gtagaagaaggtacggttgcagtagttggagatacattaattaaatttgatgctccagga
tacgaaaaccttaaatttaaaggcgacgatcatgacgaagctcctaaagctgaagctact
ccagcagcaactgcagaagtagtaaatgagcgcgtaatcgctatgccatctgttcgtaaa
tatgctcgtgaaaacggcgtagacattcataaagtagctggttctggtaagaacggtcgt
atcgtaaaagctgacatcgatgcatttgcaaatggtggacaagcagtagcagcaactgag
gctccagcagcagtagaagctactccagcagcagcgaaagaagaagcaccaaaagcacaa
ccaatcccagctggtgaatatccagaaactcgtgagaaaatgagtggtatccgtaaagca
attgcgaaagcaatggttaactctaaacatacagctcctcacgtaacattaatggatgaa
gtagatgtaactgaacttgttgctcaccgtaagaagttcaaagctgtggcagctgacaaa
ggtattaaattaacttaccttccatacgttgttaaagctttaacatctgcattacgtgaa
tacccaatgttaaacacttctttagatgatgcttctcaagaagtagttcataaacattac
ttcaacatcggtatcgcagctgatacagacaaaggtctattagtaccagttgttaaagat
acagatcgcaagtctatcttcacaatttctaacgagatcaatgatcttgctggtaaagca
cgtgaaggtcgtttagctcctgctgaaatgaaaggcgcttcttgcacaattacaaacatt
ggttctgcaggtggacaatggttcactccagttatcaaccacccagaagtagcaatcctt
ggtatcggccgtatcgctgagaaaccagttgtgaaaaacggtgagatcgttgcagctcca
gtattagcattatctctaagctttgaccatcgtttaattgacggcgcaactgctcaaaaa
gcattaaaccaaattaaacgtctattgaatgacccacaattattagtaatggaggcgtaa

DBGET integrated database retrieval system