KEGG   Bacillus anthracis CDC 684: BAMEG_4523Help
Entry
BAMEG_4523        CDS       T00886                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAMEG_4523 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMEG_4523 (glcK)
   00052 Galactose metabolism
    BAMEG_4523 (glcK)
   00500 Starch and sucrose metabolism
    BAMEG_4523 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BAMEG_4523 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAMEG_4523 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BAMEG_4523 (glcK)
Enzymes [BR:bah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BAMEG_4523 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4081860..4082843)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtgtacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggt
gaattaaaaagtaagttaatcggtattggtatgggagctcctggtcctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaaaaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaatttagcggcactt
ggtgaaatgtggaagggtgctggtgaaggagcaaaagatttaatttgtatgacacttggc
actggtgttggcggcggtgtaattgccaatggtgagattgtacatggcgtaagcggtgct
gctggtgagattggacacattacagtcgttacagagaatgctttcccatgtaattgcggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtacgtgttgctatgcag
aaaatacaagagactgataaagaaagtattctacgttctatgttagcagaagaagggcgt
attacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttcgagcacgttgaat
ccagagaaaattgttattggtggaggcgtttctaaagctggagatgcactattagaacca
attcaacgttatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system