KEGG   Bacillus anthracis CDC 684: BAMEG_4795Help
Entry
BAMEG_4795        CDS       T00886                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00071  Fatty acid degradation
bah00362  Benzoate degradation
bah01100  Metabolic pathways
bah01120  Microbial metabolism in diverse environments
bah01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BAMEG_4795
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAMEG_4795
Enzymes [BR:bah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BAMEG_4795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACP12267
Structure
PDB: 

Jmol
Position
complement(4330142..4330918)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcgcaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataatattcgtgttgttgttattcatggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaaccagttatcgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagcgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacggcccgtgctgtactagagttattgcaaacgacgaaatcgtctcattat
tatgagggtgtacaacgcgaagctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtagcagcatttttagaaaagcgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system