KEGG   Bacillus anthracis CDC 684: BAMEG_4947Help
Entry
BAMEG_4947        CDS       T00886                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bah  Bacillus anthracis CDC 684
Pathway
bah00010  Glycolysis / Gluconeogenesis
bah00620  Pyruvate metabolism
bah00640  Propanoate metabolism
bah00680  Methane metabolism
bah01100  Metabolic pathways
bah01110  Biosynthesis of secondary metabolites
bah01120  Microbial metabolism in diverse environments
bah01130  Biosynthesis of antibiotics
bah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMEG_4947 (acsA)
   00620 Pyruvate metabolism
    BAMEG_4947 (acsA)
   00640 Propanoate metabolism
    BAMEG_4947 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BAMEG_4947 (acsA)
Enzymes [BR:bah01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BAMEG_4947 (acsA)
Lipid biosynthesis proteins [BR:bah01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BAMEG_4947 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FPRL1_inhibitor
Motif
Other DBs
NCBI-ProteinID: ACP15067
Position
complement(4465562..4467280)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYDEAYANFNWEEVNKNFTWNEAGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERVPLNDLPALKTVFLVGDHVEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLKEDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPEAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMNAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIGKGWPAMMRGIW
NNKQKYESYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRAGYEPSEELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgatgag
gcatacgcgaattttaactgggaagaggttaataaaaactttacttggaatgaagcaggc
cgagtaaatatggcgtatgaagcaattgataagcatgcgaaatccgatcgaaagaataaa
gtagccctttattatcaagatggatctcgaaaagagaagtatacatttaaggaaatgaag
gatttttctaataaagcaggaaatgtcctgaaaaattatggcgatgtagaaaaaggcgat
cgcgtttttatttttatgccgcgttccccagagttatatttcgcccttcttggtgcagtg
aaattgggagcaattgttggtccgctatttgaagcatttatggaaggcgcagttcgcgat
cgtttagaagatagcgaagcaaaagtgttaattacaacacctgaattgttagagcgtgta
ccattaaatgatttacctgctttaaaaacagtcttccttgttggggatcatgtagaagaa
ggcggtaaaacggtagcgttcaatcctttatttgaacaagcttcaaaagaattacatatt
gaatggttaggccgtgaagacggtttgattctacattacacgtctggttctactggtaag
ccaaaaggtgtgcttcatgcgcaaaacgcaatggttcagcactatcaaacggcgaagtgg
gtattagatttaaaagaagacgatgtatattggtgcacagctgacccaggctgggtaacg
ggaactgcttacggtatttttgcaccgtggttagtcggggcatcaaatgttattttaggc
ggacgctttagtccagaagcgtggtatgaagcactgcaagattacggtgtaacagtttgg
tatagtgcaccaacagcgttccgtatgttaatgggtgctggacaagatgcaattaaaaaa
tacgatttatcacaagtgcgtcacgtattaagcgttggtgaaccgttaaatccagaagta
attcgctggggtatgaacgcctttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagttatttgtaactacccttgtatggaaatccgtccaggttcaatgggt
aagccaattccaggtgtaaaagcagcgattgttgataatgaaggaaatgaagtgccacca
tacacaatgggtaacttagcaattggcaaaggttggccagctatgatgcgcggaatttgg
aataacaagcaaaagtatgagtcttacttcatgccaggcgattggtacgtatcaggtgac
tctgcatacatggacgaggatggatacttctggttccaagggcgtattgacgatgtaatt
atgacgtcaggtgagcgcgttggtccgtttgaagtggaaagcaaattaatcgagcatgct
gctgttgcagaagctggtgtaattggtattcctgatccggtgcgcggcgaaattattaaa
gcatttatcgcgcttcgtgcagggtacgaaccatctgaagaattaaaagaagaaattcgt
caatttgtaaagaaaggtctagcagctcatgcagcgccaagacaaattgaatttagagat
aaattaccgaaaacgagaagcggtaaaattatgcgccgcgtattaaaagcgtgggagtta
aacttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system