KEGG   Bacillus anthracis CDC 684: BAMEG_4986Help
Entry
BAMEG_4986        CDS       T00886                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAMEG_4986
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAMEG_4986
Enzymes [BR:bah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BAMEG_4986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4501767..4502804)
Genome map
AA seq 345 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGETE
GFTSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMILGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGAYELVSFESGRRLNMVPDFAEAVVTGEDVNALTVAY
EEYLQTAKKIGEAIVEGNTVTLQIKGISAHGSTPEKGENAGLLLANFLTTVALDGKANAF
ATFATETFTGDIFGEKATIAYKDEVSGPLTVNVGRLSYTKRMVAI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaattaattggacagaagaagttgcaaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagagtcggcaaaagagggcgca
ccgttcggtgaaggtgtagaaaaagcgctatctttcatgttacataaaggagaaacggaa
ggttttacttctaaaaatttagaagggtatgcaggtcatcttgaaatgggacaaggagaa
gaattagtaggtattctttgtcacgttgacgttgtaccagaaggagatggttggacgact
cctgcatatagtgcagatattcgcgatggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcttattatgcgatgaaaattgtgaaagaattaggtttacct
ctttcaaaacgcgttcgtatgattttaggaacagatgaggaaagcaattggaaatgtgta
gatcactactttaaaaatgaagaaatgccaacaatcggttttgcaccagacgcggacttc
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaagaaaggtgcatatgaacttgtttcatttgagtcaggtcgccgtttaaatatggtt
cctgattttgcagaagcggttgttacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaataggtgaagcaattgtagaaggtaatacggtg
acattgcaaattaaagggatttcagctcacggatctactcctgaaaaaggagaaaatgca
ggtttattactggcaaacttcttaacgacagttgctcttgatgggaaagcaaatgcattt
gcaacgtttgcaacagaaacatttactggtgatatttttggagaaaaggctacgattgct
tataaagatgaagttagcggtccattgacagtgaatgttggacgcctttcttatacgaaa
agaatggtggcaatttag

DBGET integrated database retrieval system