KEGG   Bacillus anthracis CDC 684: BAMEG_5209Help
Entry
BAMEG_5209        CDS       T00886                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAMEG_5209 (gtaB)
   00052 Galactose metabolism
    BAMEG_5209 (gtaB)
   00500 Starch and sucrose metabolism
    BAMEG_5209 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BAMEG_5209 (gtaB)
Enzymes [BR:bah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAMEG_5209 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4679503..4680390)
Genome map
AA seq 295 aa AA seqDB search
MKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEG
RRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQTNQES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gctacaaaagcaatgccaaaagaaatgttaccgattgttgataaaccaactatccaatac
attgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaaacg
aagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttattagaa
aagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacattcac
tatatccgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcacgtaaattc
atcggtgatgagccatttgctgttttattaggtgatgatatcgttcaagctgaaaaacca
tgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgtacaa
acggttccagaagacgaaacacaccgctacggaattattgatccgttagagcaagaagga
cgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttcaaac
ttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaacaacaa
catgttggtgctggtggtgaaatccagttaacagatgctattcaaagcttaaacgaaatt
caacgtgtattcgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagctagga
ttcgttcaaacgacaatcgaaatggcactgcaacacccagaattacgtgatgacatggtt
acgatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system