KEGG   Bacillus anthracis CDC 684: BAMEG_5477Help
Entry
BAMEG_5477        CDS       T00886                                 

Gene name
comFA
Definition
comF operon protein 1
Orthology
K02240  
competence protein ComFA
Organism
bah  Bacillus anthracis CDC 684
Module
Competence-related DNA transformation transporter
Brite
Secretion system [BR:bah02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) family protein [MD:M00429]
   BAMEG_5477 (comFA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4915481..4916830)
Genome map
AA seq 449 aa AA seqDB search
MLAGKQLLLEELPSDLRRELSDLKKEGEVICVQGVIKKASKYICQRCGNIEQRLFASFLC
KRCSKVCTYCRKCITMGRVSECAVLVRGIHERKGERELHSLQWKGSLSLGQELAAQGVIE
AIKQKESFFIWAVCGAGKTEMLFYGIEEALQKGERVCIATPRTDVVLELVPRLQEVSPSI
NVAALYGGSVDREKDAALVVATTHQLLRYYRAFHVMIVDEIDAFPYHVDQMLQYAVQQAM
KEKAARIYLTATPDEKWKRNFRTGKQKGIIVSGRYHRHPLPVPLFSWCGNWKKSLHHKKI
PRVLLQWLKMYVNKKYPIFLFVPHVRYIEEIGLLLKGLDHRIDGVHAEDPMRKEKVEAFR
KGDIPLLVTTTILERGVIVKNLQVAVLGAEEEIFSESALVQIAGRAGRSFEEPYGEVVYF
HYGKTESMVRAKRHIQSMNKSAKEQGLID
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctggaaagcagttactattagaagaactcccttcagatttacggagagaatta
agtgatttgaaaaaggagggagaggtcatatgtgtacaaggcgtaataaagaaggcttct
aaatatatatgtcagcgctgcgggaatatagagcagcggctatttgcatcatttttatgt
aaaaggtgcagtaaagtatgtacgtattgccggaagtgtataacgatggggagagttagt
gaatgtgctgtacttgttcgcgggattcatgaaagaaaaggagaaagggaattacattcg
ttacagtggaaagggagtttgtctcttggtcaggagctggcggcgcaaggtgttatagaa
gctattaagcaaaaagaatctttttttatttgggctgtgtgcggggctggaaaaacagaa
atgttattttacggtatagaagaggcacttcaaaaaggagaaagagtgtgtatcgcaacg
ccaaggacggacgttgtactggaattagtaccgagattacaagaagtgtctccaagtata
aatgtagctgctttatacggagggagtgtagatcgtgaaaaagatgcagcgttagtcgtt
gcaacgacgcatcaattgttacgttattatagagcgtttcatgtaatgattgtagatgag
attgatgccttcccgtatcatgtggatcaaatgttacagtatgcagtgcagcaagcgatg
aaagagaaagcagcgcgtatttatttaacggcaacccctgatgaaaagtggaagcgcaat
ttcagaacggggaaacaaaaaggtatcattgtctctggacgataccatcgtcatccgtta
ccagttcctctatttagttggtgcggaaattggaagaaaagcctccatcataaaaaaatt
cctcgtgtgttactacaatggttaaaaatgtacgtaaacaaaaaataccctattttttta
tttgttcctcatgtgcgatatatagaagaaataggcctgttattgaaagggttggatcat
agaatcgatggcgtacatgcagaagatccgatgagaaaagaaaaagtggaagcgtttaga
aagggagacattccgttattagttacaacgacaattttagaaagaggggtaattgtgaag
aacttacaagtggctgtgttaggggctgaagaagaaatattttcagaaagtgcgctcgta
caaattgcaggccgagcaggtcgtagttttgaagaaccgtatggtgaggttgtttatttt
cattacggtaagacagagtcgatggtacgtgcgaaaagacatattcaaagtatgaacaaa
agtgcgaaagaacaaggattaattgattaa

DBGET integrated database retrieval system