KEGG   Bacillus anthracis CDC 684: BAMEG_A0122Help
Entry
BAMEG_A0122       CDS       T00886                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bah  Bacillus anthracis CDC 684
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bah00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAMEG_A0122
   00052 Galactose metabolism
    BAMEG_A0122
   00500 Starch and sucrose metabolism
    BAMEG_A0122
   00520 Amino sugar and nucleotide sugar metabolism
    BAMEG_A0122
Enzymes [BR:bah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAMEG_A0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pX01:112887..113774
Genome map
AA seq 295 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVSSGIEDIIIVSGRGK
HVIEDHFDKSYELEQTLFKKNKIKTLEDIECISNLANIHYIRQKEPKGLGHAIYCARRFI
GEEPFAVLLGDDIVSSTYPCLKQLIDVYEEHHCSVVGVQRVLETEVSKYGIVKSANQNVN
QSIIPISMLVEKPPLETAPSNLAIMGRYILKPDIFEVLKNLPVGSGGEIQLTDAINVLNK
QQKVLAFEFDGKRYDVGDKFGFIKATIDFALQRESLKEDVLSYLRNITRDKLINK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgaagattagaaaagcgattatcccagcagcgggattaggcacaagatttttacccgca
acaaaagcacaacctaaagaaatgttgccaattgtagataagccaactattcaatatatt
gttgaagaagctgttagctcaggaatagaggatattattattgtaagtgggagagggaag
catgttatagaagatcattttgataaatcttatgagctagaacaaactttatttaagaaa
aacaaaataaagactcttgaagacattgaatgcatttctaatttagcgaatatccattat
attcggcaaaaagaacctaaaggattaggacatgctatatattgtgctagacgttttata
ggtgaagaaccttttgcagttttacttggtgatgatattgttagctctacgtatccatgt
ctcaagcaattgatagatgtttatgaggaacatcactgttcagtggtaggtgttcaaagg
gtattagaaacagaagtgtctaaatatggaatagttaaatcggcaaatcaaaatgttaat
caatctattattcctatttctatgctagttgaaaaaccacctctggaaactgcaccttca
aatttagctataatgggcagatatatactaaaaccagatatttttgaggtgttaaaaaat
ttacctgtcggatcaggtggagaaattcagttaaccgatgcaatcaatgttttaaataaa
caacaaaaagtactcgcctttgaatttgatgggaaaagatatgatgtaggggataaattt
ggctttattaaagcgactatagattttgcacttcagagagaaagtctaaaagaagatgtt
ttgagttatttgagaaatatcactcgagataaacttatcaataaataa

DBGET integrated database retrieval system