KEGG   Bacillus anthracis A0248: BAA_0021Help
Entry
BAA_0021          CDS       T00892                                 

Definition
deoxynucleoside kinase family protein (EC:2.7.1.-)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bai  Bacillus anthracis A0248
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BAA_0021
   00240 Pyrimidine metabolism
    BAA_0021
Enzymes [BR:bai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BAA_0021
    2.7.1.76  2'-deoxyadenosine kinase
     BAA_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22356..23024)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccaaatgacgcagtaatcactatcgctggaaca
gtaggtgtcggtaaatccactatgacaactgcattagctaacgctttaggatatcgcaca
tcatttgaaaaggtagattctaacccgtatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtgtactttttagcagaacgatttaaagaacaaaaaaggatt
tttgaatacggtggtggttttgttcaagatcgctctatctatgaagacactggcattttt
gcaaaaatgcatcacgaaaagggtacaatgacggaaactgattatgaaacatataaaggt
ttatttgacgctatggtcatgactccttacttccctcatccagatttactaatctactta
gaaggttctttcgatgatatcgttgatcgtatccaagaacgtggacgtccgatggaacag
caaacgccaattgagtattggaaagagatgcatgggcgttatgaaaactggattaataac
tttaattcatgccctgtcttacgattaaatattaatgaatacgatattttaaaagatggc
gattccattgaaccaatcattaaaaagatcggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system