KEGG   Bacillus anthracis A0248: BAA_1215Help
Entry
BAA_1215          CDS       T00892                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bai  Bacillus anthracis A0248
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAA_1215 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAA_1215 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BAA_1215 (aceB)
Enzymes [BR:bai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BAA_1215 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1104577..1106166
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRMKKQQKIDAGEF
PKFLEETKRIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAIEGQINLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKN
MSGSLVDFGLYFFHNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTM
TAPFMRAYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgtgggagaaatgttaccagcgtacaacgaa
atattgacacctgaggcgcttagttttttaaaggaactacatgaaaattttaatgagcgc
cgcatagaacttttacaaaagcgtatgaaaaaacaacagaaaattgatgcaggagagttt
ccgaagtttttagaagaaacaaagcgtatacgtgaagcggattggacaattgctaaattg
ccaaaagatttagaggatcgccgcgtagagattactggtccagtagatagaaagatggtt
attaacgctttaaattcgggagcacatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcaattgaaggtcaaataaacttacgagatgcagtaaagggaacg
atttcacataaaaatgaaaacggaaaagaatatcgtttaaatagtaaaacagctgtatta
attgtgcgtccaaggggatggcatttagaagaaaaacatatgcaagttgacggaaaaaat
atgtctggtagcttagtagatttcggactttattttttccataatgcgaaagctctttta
gaaaaaggaagcggtccatacttttacttaccgaaaatggaaagctatttagaagcaaga
ttatggaatgatgttttcgtatttgctcaaaaatatatcggtattccaaatggaacgatc
aaagcaacggtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagcttaaagatcattctgctggattaaattgcggaagatgggattatatttttagtttt
ctaaaagctttccgtaatcataatgaatttttacttcctgatagagcgcaagtcacgatg
acggcgccgtttatgcgcgcgtattctttgaaagtcattcaaacttgtcaccgccgtaat
gcaccagctattggagggatggcagcacaaattccgattaaaaacaatcctgaagcgaat
gaagctgcttttgaaaaagtgcgtgctgataaggagcgagaagctttagacggtcatgac
gggacttgggttgcccacccgggacttgtgccagtcgcgatggaagtatttaatcacatt
atgaaaacaccgaatcaaatttttagaaaacgagaagaaatacatgttacagaaaaggat
ttattagaagtaccagtgggaacgattacagaagagggtcttcgtatgaatattagcgta
ggcattcaatatatcgcatcttggttaagcggacggggagcagcaccaatttataactta
atggaagatgcggcaacagctgaaatctcaagagcacaagtatggcaatggattcgccat
gaaggtggaaaattaaatgatggccgtaatattacacttgaattaatggaagagttaaaa
gaagaagagttagcaaaaatagaaagagagattggtaaagaagcctttaagaaagggaga
ttccaagaggcgacaacgttgtttacaaatctcgttcggaatgatgaattcgtaccattt
ttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system