KEGG   Bacillus anthracis A0248: BAA_1330Help
Entry
BAA_1330          CDS       T00892                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bai  Bacillus anthracis A0248
Pathway
bai00260  Glycine, serine and threonine metabolism
bai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bai01100  Metabolic pathways
bai01110  Biosynthesis of secondary metabolites
bai01130  Biosynthesis of antibiotics
bai01230  Biosynthesis of amino acids
Module
bai_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAA_1330 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAA_1330 (trpA)
Enzymes [BR:bai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAA_1330 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: ACQ48269
UniProt: C3P3U1
Position
1208666..1209442
Genome map
AA seq 258 aa AA seqDB search
MGVERIKAAFENGKKAFIPYVMGGDGGLEILKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQIPFVLMTYLNPVLAFGKERFIENCMEAGV
DGIIVPDLPYEEQDIIAPLLREANIALIPLVTVTSPIERIKKITSESEGFVYAVTVAGVT
GVRQNFKDEIHSYLEKVKSHTHLPVVAGFGISTKEHVEEMVTICDGVVVGSKVIELLENE
KREEICEFIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaagaattaaagcagcatttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaatattaaaagaaagaattcgttttctagacgaa
gcgggagcaagcatcgttgaaattggtatcccgttttcagacccagtcgcagatggccca
acgattcaaagagcagggaaacgagcgctagatagcggtgtaacagtaaaaggcattttt
caagcattaatagaggtaaggaaagaagtgcaaattccgtttgtactcatgacatattta
aatccagtacttgcattcgggaaagaacgatttatcgagaactgtatggaagcaggtgta
gacggcatcatcgttccagacttaccgtatgaagaacaagacattattgctccgttactt
cgagaggcaaacattgcgctcattccacttgttactgttacgagcccaattgagcgaatc
aaaaaaattacgagtgaatcagaaggatttgtctacgccgttacagtagcgggcgtaaca
ggagtacgtcaaaattttaaagatgagattcatagttacttagaaaaagtgaaatcgcat
acacatttaccggtagtggcagggttcggtatttcaacaaaggaacatgtggaagaaatg
gttacaatatgtgatggtgttgtcgttggaagtaaagtgattgagctattagaaaatgaa
aaacgagaagaaatatgtgaattcatacaggcaacaaaacaaaaagaagaggcgtaa

DBGET integrated database retrieval system