KEGG   Bacillus anthracis A0248: BAA_1819Help
Entry
BAA_1819          CDS       T00892                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bai  Bacillus anthracis A0248
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAA_1819
   01230 Biosynthesis of amino acids
    BAA_1819
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAA_1819
  Energy metabolism
   00680 Methane metabolism
    BAA_1819
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAA_1819
Enzymes [BR:bai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BAA_1819
Exosome [BR:bai04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BAA_1819
  Exosomal proteins of melanoma cells
   BAA_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1637494..1638069
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHCDAENVTSLLKDKHIDVVISSPYKRAVQTVQG
IANTYHVSIEIEEGLRERLLSSEPIADFNDAIENVWEDWSFAYEGGESNDVAQRRAVICM
QSILKKYKGKNIVIGTHGNIMVLLMNYFDSKYDFRFWKTLRMPDIFKLNFHNEDLVSAER
IENTGHQINNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatatatttcgttcgccatgcccattctacatatacaaaagaagaacgggag
cgtcctttatctgaaaaagggcactgtgatgcagaaaacgttacgagcttattaaaagat
aaacacattgatgtagtgatttctagcccgtacaaaagagcagttcaaactgtacaagga
attgcgaatacatatcatgtatcaatagaaatagaagaaggtttacgagaaaggttatta
agttcagagccaatagcagattttaatgatgctattgagaatgtgtgggaagattggagt
tttgcatacgaaggcggagaatccaatgatgtagcacaaagacgcgctgtaatatgtatg
caaagtatattaaaaaaatataaaggtaaaaatattgtaataggtacgcatgggaatatt
atggtattacttatgaattattttgattcaaaatatgattttcgattttggaaaacactt
cgtatgcccgatatatttaagttgaattttcataatgaagatttagtttctgccgaaagg
atagagaatacgggtcatcagataaataatttgtaa

DBGET integrated database retrieval system