KEGG   Bacillus anthracis A0248: BAA_1826Help
Entry
BAA_1826          CDS       T00892                                 

Gene name
asnO2
Definition
asparagine synthetase, glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bai  Bacillus anthracis A0248
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAA_1826 (asnO2)
Enzymes [BR:bai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BAA_1826 (asnO2)
Peptidases [BR:bai01002]
 Cysteine Peptidases
  Family C44
   BAA_1826 (asnO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641176..1642999)
Genome map
AA seq 607 aa AA seqDB search
MCGITGWVDWKEDLSNQHVILKKMANRIQHRGPDAEGFWFSPRAAFAHRRLIVIDPEGGA
QPKTFRAGDYTYALTYNGEIYNFRELREQLQKCGHTFETHSDTEVLLHAYLEWKEDCVQH
LNGIFAFALWDDQKQRLFLARDHLGVKPLFYTERNDSIIFGSEIKALLAHPSVPAEIDAD
GINEIFGLGLFRTPGCGVFKHIEEVRAGHSITFTRDKKVVTKYWNLESKVHTDSIEDTSS
HILSILQDTVKRQLIADVPLVCMLSGGLDSSGITALAGKEFAAENKTLHTYSVDFVNSAK
DFELTFARTGLDAPWVKRVSEHVGTSHHDIIVNAEELANHLFVPLRAKDLPSAGEMETSL
YLLFCEMKKDATVALSGESADEVFGGYPWFHQEELLYVDKFPWLTNWKNTSPLLLHEISN
QCNLENYIDTRFQEAILEVPTLEGESKKSAKQRQMFYLFLTRFLPFLLDRKDRMSMAVGF
EVRVPFCDYRLVEYLWNVPFNIKSIDNIEKGILRRALKPALPDDVRNRRKSAYPTSQDPQ
YLQTIRHLSLDMCSNKNNPIFSLINHSTLLAIADGSNKEINNFEARSAMEYMLQVNEWLK
TYHIHIA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacaggttgggtagattggaaagaagacctttcaaatcaacatgttatt
ttaaaaaagatggcaaatcgtattcagcatcgcggtcctgatgctgaaggattttggttt
tcacctcgtgcggcctttgcacaccgtcgtttaattgtaattgatccagaaggcggggca
cagccgaagacatttcgtgctggtgattatacgtatgctcttacttataatggagaaatt
tataatttccgtgagctgagggaacaacttcaaaaatgtggtcatacatttgaaacgcat
tcagatacagaagtgttactacatgcttatttagaatggaaagaagactgcgtgcaacat
ttaaacggcattttcgctttcgccttatgggatgatcagaagcaacgactgtttttagca
cgtgatcatttaggtgtaaaaccgctcttttatacagaaagaaatgacagtattattttc
ggatctgaaataaaagcattattagctcatccatctgttcctgctgaaattgatgcggat
ggcataaatgaaatatttggattagggctatttcgaactccaggatgtggcgtctttaaa
catattgaagaagtgcgtgccggacattctatcacatttacacgtgataaaaaagtagtt
acgaagtattggaatttagaaagtaaggtccatacagattctatagaagatacatcatca
catattttatctattttacaagatacagtaaaaagacaattaattgccgacgtccctctc
gtttgcatgttatcaggaggattagattctagcggtattactgcactagcaggaaaagaa
tttgctgctgaaaataaaacacttcatacgtattccgttgactttgtaaatagcgcaaaa
gatttcgagctgacatttgctcgcactggtttagacgctccttgggtaaaacgcgtttct
gaacatgtagggacatctcatcatgatattattgtgaatgctgaagaattagctaatcac
ttattcgttcccctccgtgcaaaagatttaccgagtgctggcgaaatggaaacttcacta
tatttactattttgcgaaatgaaaaaagatgcgaccgtagctttatccggcgaatctgct
gatgaagtattcggtggatacccttggtttcatcaagaagaattactatatgtcgataag
tttccttggctaacaaattggaagaatacatctcctcttctactacatgaaataagtaac
caatgtaatctagaaaactatattgatacacgcttccaagaagcgatacttgaagtacct
actcttgaaggcgaaagtaaaaaatccgcgaaacaacgtcaaatgttttatttattttta
acgagatttcttccgttcttacttgaccgtaaagatcgtatgagtatggctgtaggattt
gaagttcgtgtaccgttttgcgattatcgattagttgaatatttatggaacgttcctttc
aacataaaaagcattgataatattgaaaaaggtattttacgtagagcactgaaacctgct
ttacctgacgatgtacgtaatagaagaaaaagtgcgtatccaacttcacaagacccacag
tatttacaaacaatccgtcatttatcactcgacatgtgcagtaataaaaacaaccctatt
ttctcacttattaatcattccacattacttgccattgccgatggaagtaataaagaaatt
aacaatttcgaagcaagaagtgctatggaatacatgctacaagtaaatgaatggttaaaa
acatatcatattcatattgcttaa

DBGET integrated database retrieval system