KEGG   Bacillus anthracis A0248: BAA_2853Help
Entry
BAA_2853          CDS       T00892                                 

Gene name
fdX
Definition
(GenBank) ferredoxin
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2
Motif
Other DBs
NCBI-ProteinID: ACQ48005
Position
2593335..2593601
Genome map
AA seq 88 aa AA seqDB search
MPKLTIEDNGVNILHRCGGKARCTTCRVEIIAGDFCEASANEKNAMTEKGIEDHLRLSCQ
MRVHKDIVVRPVLTVESSGLDAGPRPAE
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
ttgccaaaattaacaattgaagataacggtgtaaacatactccatcgttgcggcggaaaa
gcacgttgcacaacttgtagagtagaaattatagccggtgatttttgtgaagcgagtgcg
aatgaaaaaaatgcgatgacagaaaaaggaattgaagatcatttacgattatcttgtcaa
atgcgtgtacataaggatatagtagttcgcccagtacttacagttgaaagttcaggtctt
gatgctggaccacgtccggcggagtaa

DBGET integrated database retrieval system