KEGG   Bacillus anthracis A0248: BAA_2865Help
Entry
BAA_2865          CDS       T00892                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2600287..2600691)
Genome map
AA seq 134 aa AA seqDB search
MYTYKLQDEKPICSEKLKRLYDSVGWWPERKEIDIQKMLKNSIAIGVWKENELIGFARVV
SDGVFRAYLEDVVVHESVRNKGIGEKMLTMLLEEISYIDIVSLFCGEKLITFYGQQQFQT
TKQIVMHRNQIVKE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgtataaattacaagatgagaaaccaatctgttcagaaaaattaaagaggctt
tatgattctgtcggttggtggccagaaagaaaagaaatcgatattcaaaaaatgttaaaa
aacagtatagcaattggggtatggaaagaaaatgagttaatcggttttgctagagttgtt
tcagatggtgtttttcgagcgtacctagaagatgttgttgtgcatgaaagtgtaagaaat
aaaggcattggtgagaagatgcttacaatgttgcttgaagagatatcttatattgatatt
gtgagcttattttgcggagagaaacttataactttctatgggcaacagcaatttcaaacg
acgaaacaaattgtaatgcatcgtaatcaaatagtgaaagaatag

DBGET integrated database retrieval system