KEGG   Bacillus anthracis A0248: BAA_2866Help
Entry
BAA_2866          CDS       T00892                                 

Definition
(GenBank) putative S-layer protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLH Lactamase_B Lactamase_B_2 Lactamase_B_6 DUF3574
Motif
Other DBs
NCBI-ProteinID: ACQ50114
Position
2600939..2602324
Genome map
AA seq 461 aa AA seqDB search
MKKFSLLLTAFVMILTLFIPNLTSAKSFPDVQSNHWAIKEINYLSDKGIINGTPEGTFKP
SDYVTRGQMALMLDLSLKLEKPSNYNHIFSDVAKGVYYYDSVHKLAHNNIVQRETNYFPD
RSLTRAEMAVVLVKTFNLKPTGADVNFPDVPSNHWGYNYVKILAQNNITAGFPDGTFGPD
VKVTREQFAAFLARVLEPSFRPGLPKPKGELEVHYINVEQGDATFIKSPSGETILIDGGN
NGKGKVVANYLKGLGFQTIDYMIATHPDADHVGGLDEVLYAINVKNVYAPKVSHTTQTFK
DFLTAVANKGLTIKEAKSGVTLPINGLNSQFLAPVKEYGNDLNEWSAVLKVTHGSKSFLF
TGDAESKSEKDMVATYGSGLKSDVLKPGHHGSKTSSSQPFLDAVKPSIAIISAGAGNRYG
HPTQETLAKLNAMSVKVYRTDLNGTVIINSDGSNISVRAER
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagtttagtttattattaacagcatttgtcatgattttaacattgttcattcca
aatcttacaagtgctaaatctttccctgatgtccaatctaatcattgggcaattaaagaa
attaactatttatcggataaaggtatcattaatggtacaccagaaggaacttttaaaccg
agtgattatgtaactcgtggacaaatggccttaatgctagatttatcattaaaattagaa
aaaccatctaactataatcatattttttccgatgtagccaaaggtgtctattactatgat
tctgtacataagttagcacataacaatattgtacaacgtgaaacaaactacttccctgac
cgctcattaactcgtgcagaaatggcagtagtactagttaaaacttttaatttgaaacct
acaggtgctgacgtcaatttccctgatgttccatctaatcattggggttacaattatgtc
aaaattttagctcaaaataatattacagctggatttcctgatggtacatttggtccagac
gtaaaagtaactcgtgaacagttcgctgcattcttagcaagagtattagaaccaagtttc
cgtccaggtcttcctaagcctaaaggagagttagaagtccattatataaatgtcgaacaa
ggtgatgctacatttattaaatctccaagtggagaaacgatccttattgatggcggaaat
aacggaaaaggtaaagttgtagcaaattatttaaaaggattaggattccaaactatcgat
tatatgattgccactcatcctgatgccgatcatgtaggcggattggatgaagtactttat
gctataaatgtaaaaaacgtttacgcacctaaagtaagtcatacgacacaaacgtttaag
gactttttaactgcagtagctaacaaaggattgactattaaagaagcgaaatctggagta
actttaccaatcaatggtttaaactcacaatttttagctcctgttaaagaatacggtaac
gatctaaatgagtggagtgctgtattaaaagtaacacatggcagcaaatctttcttattt
actggtgatgctgaatctaaaagtgaaaaagatatggttgcaacgtatggttccggccta
aaatccgatgtattaaaacctggacatcacggaagtaagacatcttcttctcagccattt
ttagatgcagtgaaaccaagtatcgctataatcagtgcaggtgcaggtaaccgatatggc
catcctactcaggaaactttagcaaagttaaatgcaatgtctgttaaggtatatagaact
gatttaaatggaactgtaattattaatagtgatggttctaacatttctgtaagagcggag
agataa

DBGET integrated database retrieval system