KEGG   Bacillus anthracis A0248: BAA_2894Help
Entry
BAA_2894          CDS       T00892                                 

Gene name
dapA1
Definition
(GenBank) dihydrodipicolinate synthase
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
bai  Bacillus anthracis A0248
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAA_2894 (dapA1)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BAA_2894 (dapA1)
Enzymes [BR:bai01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     BAA_2894 (dapA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2627927..2628823)
Genome map
AA seq 298 aa AA seqDB search
MKIIKGAFPVLITPMDEFQEINWNGVKQNVNYFIEQKVAGIIINGSTGEFVSLSKEERFK
MVETVLKEVNGRIPVIVGTAAETTKETIEFTKHAETHGADCALIINSYYCKPKEEEIYFH
FKEISNAVNIPIMLYNNPFTSGVDMSTELMLRIGKDCENVTHIKESSGDIRKARDLVRQG
EGAFQVFCGSEDLVMESYLVGATGWVSVAGNVVPGLVTKMYEHFQNGELEKAWEINDAIL
PLCEFLEGSGKYVQIVKRSMELQGQAGGPSRYPRLGLTEEEDQKLQAIISKIAAHAAV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataattaaaggggcatttccagtattaatcacaccgatggatgagtttcaagaa
attaattggaacggtgtaaaacaaaacgtaaactactttattgagcaaaaagtggctggc
attattataaacggaagcacaggagagtttgttagtttgtcaaaagaagaacgatttaaa
atggtagaaacagtattaaaagaagttaatggccgtattccggttattgttggaactgca
gcagaaacgacgaaagaaacgattgaatttacaaaacatgcagaaacgcacggagcggac
tgcgcattaattattaactcatactattgtaagccaaaagaagaggaaatttattttcac
tttaaagaaatctcaaatgctgtaaatataccaattatgttatataataacccgtttaca
tctggtgttgatatgagtacagaactcatgctacgtatcgggaaagactgtgaaaatgtt
acacatattaaagaatctagcggagatattcgaaaagcaagagatttagtaagacaaggc
gaaggtgcttttcaagtcttctgcggatctgaagatttagttatggaatcttatttagtt
ggtgcgacgggatgggtttcagtagcaggaaatgtcgtaccgggacttgttacgaaaatg
tatgagcattttcaaaatggtgaattagaaaaagcttgggaaataaacgatgcaatttta
cctctttgtgagttcctggagggatcagggaaatatgtgcaaatcgtgaaacgttctatg
gaattacaggggcaagctgggggaccttctcgttatccaagacttgggttaactgaagaa
gaagatcaaaaacttcaagcgattatttcaaaaattgcagctcatgcagctgtttaa

DBGET integrated database retrieval system