KEGG   Bacillus anthracis A0248: BAA_2943Help
Entry
BAA_2943          CDS       T00892                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2268 Peptidase_M48
Motif
Other DBs
NCBI-ProteinID: ACQ46170
Position
complement(2671843..2672697)
Genome map
AA seq 284 aa AA seqDB search
MGKMINNTIPNFLKLWESNEVELVALKKYFTSHPEIFEEYFKYHCPNTKERLSNAINLYP
AKIEDIRIIAESLPIIIQEVTNAYHNKFNFDVKMKFHLFVGGFGSNAFVEREIIGDMFFA
AEKLSPDLNHLRVIVAHEIGHIYHNVMLQNDGMDWGKAEWADATVNLYREGIATYLSKQI
IKGLNESVYYSYDNDGERWLQCYIENEEHIKKRFLEDYIEGWTFEKEKEWFRLSGGQYFG
YNRLGYFLGTAFVEYIVQALGESEVFIFWNKYNLKSSVLDWLSK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatgataaacaatacaattccaaattttttaaaattatgggaaagtaacgaa
gtagaattagtagcgcttaaaaaatacttcacttcgcatccagaaatatttgaagaatac
tttaagtatcattgtcctaacacgaaagaacgtctttctaatgccattaatctatatccc
gcaaaaatagaagatattcgtatcattgcagaatcattaccaattattatccaagaggta
acaaatgcatatcataataaatttaactttgatgtaaaaatgaaatttcatttatttgtt
ggaggatttggatcaaatgcatttgtagaaagagagattattggagatatgttttttgcc
gcagaaaaattatctccagatttaaatcaccttcgtgttattgttgctcacgaaatagga
catatatatcataatgttatgttacaaaatgatggaatggactgggggaaagccgagtgg
gccgatgcgacagttaatttgtatcgtgaaggcattgcaacatacttatcaaagcaaatt
ataaaaggtttaaatgaatcagtatattactcatatgacaatgatggtgaacgttggtta
caatgctatatagaaaatgaagaacatataaagaaacgttttttggaagattatatagaa
ggatggacgtttgaaaaagagaaagagtggtttcggttatctggtgggcagtattttgga
tacaaccgactcggttattttttaggaactgcttttgtagaatatattgtacaagcattg
ggagagagtgaagtatttattttttggaataaatacaatttaaaaagtagtgtgttggat
tggttatcgaaatga

DBGET integrated database retrieval system