KEGG   Bacillus anthracis A0248: BAA_3002Help
Entry
BAA_3002          CDS       T00892                                 

Definition
(GenBank) hypothetical protein
Organism
bai  Bacillus anthracis A0248
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2715651..2716499)
Genome map
AA seq 282 aa AA seqDB search
MNTKLIIVEGLPGFGKSTTAQLINDILSQNKIEVELFLEGNLNHPADYDGVSCFNKFEFD
RLLSNSGDFKEVLLKRVLKKGSNYLLPYRKIKNEFGDQFSDELFNDISRNDIYELPFDKN
VELIADKWQDFAEIALEDDKVYIFECCFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIEN
LNPMLFYVEQDDLEFSFRKALKERNPEWSTGIVDYYTNQGYGKEHNHSGVEGAIKVLEAR
RNLELEIFDMLKMKKEKINNTKYEIGSYRSMLKDKLTIQMVK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaaactaataatagtagaaggtttacctggattcggaaaatcgaccactgca
cagctaataaatgatattctaagccaaaataaaattgaagttgaactatttttagaagga
aacttgaaccacccagccgactatgatggtgtatcttgttttaataaatttgaattcgac
agattattatctaacagtggagattttaaagaagtgcttcttaaaagagttttaaaaaaa
ggaagcaattatttattaccatacagaaagataaaaaatgagtttggtgaccagttttcg
gacgaattatttaacgatatttcaagaaacgatatatatgaattaccattcgataaaaat
gttgaattaattgctgacaaatggcaggactttgctgaaattgctctagaagatgataag
gtttatatttttgaatgttgtttcatacaaaatccattaacgattgggatgattaaatac
ggtgaacaaaaagaaaaaataataaattatgtaatgaaagttgcaaaaatcatagagaat
ctaaatccaatgttattctatgtagaacaagatgatcttgaattttcatttaggaaggca
ttaaaagaaagaaatccagaatggtccacaggaattgtcgattattacacgaatcagggc
tatgggaaagaacataaccattcaggagtagaaggagcgataaaagttcttgaagctaga
aggaatttagagttagaaatattcgatatgttaaaaatgaaaaaagaaaaaatcaataat
acaaaatatgaaattggctcatatagatcaatgttaaaagataagttaacaatacaaatg
gtgaaatag

DBGET integrated database retrieval system