KEGG   Bacillus anthracis A0248: BAA_3047Help
Entry
BAA_3047          CDS       T00892                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bai  Bacillus anthracis A0248
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bai01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bai00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2759927..2761171)
Genome map
AA seq 414 aa AA seqDB search
MKGEAVIFILLLNRLGAALIKIEIAASCMNKSVMYKKTLILDLGDIKVKKQRIVVKIGSS
SLADSHEGISKEQLSDHVAALARLKEEGHEVLLITSGAVAAGFSALGYPSRPVTIKGKQA
AAAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATLGELLNRSALPIIN
ENDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQKNEDAKKYYFLPEV
TEEIASLAGDAGSKLGTGGMKSKVDAAKTALSLGVSVFIGTGRGQEKFVDVLKGKGDGTY
VGNAPQKEMKINKQWIALHSVVSGQIEIDAGAATAIIQHGKSLLPAGVTNVSGFFQVGEV
VEVMTQQGRVIGKGQCTYSAEELRDVKGMQSQQIQARGERHNYEVIHRDYWVSF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgaagcggtcatttttattttgctcttaaatagactaggtgcagcactgata
aaaatagaaatcgctgcaagctgtatgaataaaagtgtaatgtataaaaaaactttgatt
ttagacttgggggatataaaagtgaaaaaacaacgaattgttgtaaagattgggagcagt
tctttggcggatagtcacgaaggcatttctaaagaacaactttcagatcatgttgcggca
ttagctcgattgaaagaggaagggcatgaagtgttgttaattacatctggggccgtcgca
gcaggtttttcagctctagggtaccctagtagacctgtaacaattaaaggaaaacaggca
gctgcggctgtcggacaaagtttgttaatgcaggcgtacacggaggaatttcgtaaatac
ggtatcgttactgcgcaactattgctgactagaagtgatttttctagaaaagaacaatat
agtaacgcttacgcgactttaggagagttactaaaccgttctgctcttccaatcattaat
gaaaatgattccatttctttagaggagctaacgttcggtgataatgatatgctgtcagct
ttagtaagcggacttgtttcggcggatatgctgatgatttttacagatgtgaacggttta
tatgataaaaatcctcagaaaaatgaggatgcgaaaaaatattatttccttcctgaagtt
acagaagaaatcgcttctcttgcaggagatgctggctccaaacttgggactggcggaatg
aaatcaaaagtcgatgctgcaaagacagcactctctcttggtgtcagtgtatttatcgga
acaggacgtggacaagagaaatttgtagatgttttgaaggggaaaggtgatggaacgtat
gtcggaaatgcccctcaaaaagaaatgaagataaataagcaatggatcgctttgcattcg
gttgttagcggacaaattgaaatagacgccggagcagctacagctatcattcagcatggc
aagagtcttcttcctgctggtgttacaaatgtttcagggtttttccaagtgggcgaagtc
gtagaagtaatgacgcaacaaggacgcgtgattggaaaaggacaatgcacatatagtgca
gaggagctaagggatgtaaaaggtatgcaaagccaacagattcaagcaagaggcgaaaga
cataattatgaagtcattcatagagattattgggtttcattttaa

DBGET integrated database retrieval system