KEGG   Bacillus anthracis A0248: BAA_3269Help
Entry
BAA_3269          CDS       T00892                                 

Gene name
cypD
Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bai  Bacillus anthracis A0248
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bai00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BAA_3269 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BAA_3269 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAA_3269 (cypD)
Enzymes [BR:bai01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BAA_3269 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BAA_3269 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2965572..2968769)
Genome map
AA seq 1065 aa AA seqDB search
MDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFRMQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETQEPNWQKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSENQEENDLLSR
MLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDSTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFEFIDYEEYQLDVKQTLTLKPGDFKIRIVPRNQTISHTTVLAPTEEKLKNHEIKQ
QVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVAALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKGDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSTRGEADASGDFEEQLEQWKQRMWSDAMKVFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEGDHLGVLPI
NSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELESLLEDGVYQEQILKKRISMLDLLEKYEACEIRFEPFLELLPAL
KPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMNVGEAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGQAKTYVQHVIKEDRIHLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRLQEEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagtatctgccattcctcaaccgaaaacatatggaccgctggggaatctc
ccattaatcgataaagataaaccgactctatcgtttattaagctggcggaagagtatggt
cccatttttcggatgcaaactttaagtgataccatcattgtcgtttctggacatgaactg
gtagcagaagtctgtgacgaaacacggttcgataaaagtatagagggtgctttagcaaag
gttcgtgcttttgctggagatggattatttacaagcgagactcaagagcctaactggcaa
aaagctcataatattttgatgcctacattcagccaaagagcaatgaaagattaccatgct
atgatggtcgatattgccgtacaactcgttcaaaaatgggcaagactgaatccgaatgaa
aacgtagatgttccggaagatatgactcgccttacattagatacaattggtctatgtggt
tttaattatcgatttaatagcttttatcgtgagacccctcatccttttattactagtatg
acccgtgcgttagatgaggcgatgcaccaattacagcggctggatatagaagacaaactc
atgtggagaacgaaacgtcaatttcagcatgatattcaatctatgttttcattagtagat
aatattattgctgaacgtaaaagtagtgaaaatcaggaagaaaatgatttgctttcccgt
atgttaaatgtgcaggatccagaaactggtgaaaaattagatgatgaaaatattcgtttc
caaattattacctttttaatagctgggcatgagacaacaagtggattgttatcttttgca
atctattttttattaaagaatccggataaattgaaaaaagcctatgaagaagtagatcgg
gttttgacagattctactccaacataccaacaagttatgaaattaaagtatatacggatg
attttaaatgaatcactacgtctatggcctactgctccagcatttagtctctatgcaaaa
gaagatacagtaattggtggaaaatacccaattaagaaaggcgaagatcgtatttctgtt
ctgattccacagctacatagggataaagacgcgtggggagacaatgtggaagaatttcaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggtcagcgagcatgtatcggtatgcagtttgcacttcatgaagcaacactcgtgatggga
atgcttcttcaacattttgaattcatcgattatgaagaatatcagctggacgtaaaacaa
acattaacgctaaagcctggtgattttaaaattaggattgtaccccgaaatcaaactatt
agccatactactgttcttgcgcctacagaggagaaactaaaaaaccatgaaattaagcag
caagttcagaaaactccttccattattggagccgataatctttcacttcttgttctgtat
ggctcagatacaggggtagcagaaggtattgcaagagaactagcagatacagctagttta
gaaggtgttcaaacggaagtggcagctcttaacgatcgaattggaagtttgccaaaagaa
ggagcggttcttattgtaacttcttcttataatggaaagccgccaagtaatgcagggcag
tttgtgcagtggctggaggaattaaaaggggatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagaccataattgggctagtacctatcagcgaattccaagatacattgat
gagcaaatggcgcaaaaaggagcaacaagattttctacacgtggagaagcggatgcaagt
ggtgatttcgaggaacagctcgagcaatggaaacaaagaatgtggtctgatgcgatgaag
gtatttggattggaacttaacaaaaacatggagaaagaacgcagtacattaagtttacaa
tttgtcagtcgtcttggaggatctcctcttgcgcgaacatatgaagcagtttatgcatct
atactagaaaatcgtgaacttcaatcatctagcagtgaaagaagcacgcgacatattgaa
atatctttgccagaaggcgctacatataaagaaggagaccatcttggggtactgccaatt
aatagcgagaaaaatgtcaaccgaattttaaaacgctttggattaaacgggaaggatcaa
gtcatactgagtgcaagtggacgaagtgtaaatcacatacctttagacagtcctgttcgt
ttatatgaccttcttagttatagtgttgaagtgcaagaagcagccactcgagcacaaata
cgagaaatggtgacattcacagcatgccctcctcataaaaaggaattggaatcattattg
gaagacggagtttatcaagaacaaatattaaagaaacgtatttcaatgttggatcttctt
gaaaagtatgaggcttgtgaaattcgatttgaaccctttttagaacttcttcctgcgctc
aaaccgcgttactattcaatttcaagctctccactcgttgcacaggatcgtctgagcatt
acggttggtgttgtgaatgcgcctgcatggagcggggaagggacatatgaaggagtcgct
tctaattatttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttcaattacctgaaaatccagaaacaccaattattatggttggaccaggc
actggaattgcaccattccgtggatttttacaagcacgacgtgttcaaaagcaaaaaggt
atgaacgtaggagaagcacatctatactttggttgtcgtcatcctgaaaaggattatctt
tatcgtacagaactagagaatgatgaaagagatggattaatctctttacacacagctttt
tctcgcttagaaggacaagctaaaacatatgtacagcatgtaataaaagaagatagaatc
catttaatttcgttattagataatggagctcatctttacatatgtggtgatggaagtaaa
atggctcctgacgtagaagataccctttgtcaagcatatcaagaaattcatgaagtcagt
gaacaagaagcaaggaattggttggaccgtctgcaagaggaaggacgatatggaaaagat
gtttgggctggtatataa

DBGET integrated database retrieval system